Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P8A5L7

Protein Details
Accession A0A2P8A5L7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
162-181SIKTKTTKATTKKRGVGKRSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 8, cyto 4.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MKISSLVLAAPFLAGYADAFPASHFTITALGDLVPSGYTGYKYSIRFLIRDTLNKATLTKCHYTWKKKQNFPDDYITCDDKNWFWRYNGDYKECGFSLSLAHSVIANDDGNKVNTTSFASVLPSQVPCGVGASQNFTCIYGSSGAQLCGLGEGTILQIPVRSIKTKTTKATTKKRGVGKRSAVVEQEEVISEVEEFEDGSMEMIGPMLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.06
6 0.07
7 0.07
8 0.1
9 0.11
10 0.11
11 0.1
12 0.1
13 0.12
14 0.13
15 0.13
16 0.1
17 0.09
18 0.09
19 0.09
20 0.08
21 0.05
22 0.05
23 0.06
24 0.06
25 0.07
26 0.08
27 0.12
28 0.17
29 0.18
30 0.2
31 0.25
32 0.26
33 0.25
34 0.27
35 0.31
36 0.3
37 0.34
38 0.36
39 0.35
40 0.35
41 0.35
42 0.34
43 0.28
44 0.29
45 0.29
46 0.28
47 0.25
48 0.33
49 0.42
50 0.49
51 0.58
52 0.64
53 0.68
54 0.72
55 0.79
56 0.8
57 0.77
58 0.73
59 0.73
60 0.63
61 0.57
62 0.54
63 0.47
64 0.37
65 0.31
66 0.27
67 0.19
68 0.24
69 0.24
70 0.23
71 0.21
72 0.25
73 0.28
74 0.35
75 0.37
76 0.34
77 0.32
78 0.31
79 0.32
80 0.28
81 0.25
82 0.17
83 0.13
84 0.11
85 0.1
86 0.1
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.06
94 0.05
95 0.07
96 0.08
97 0.09
98 0.09
99 0.09
100 0.08
101 0.08
102 0.1
103 0.09
104 0.09
105 0.08
106 0.1
107 0.1
108 0.11
109 0.11
110 0.1
111 0.1
112 0.1
113 0.1
114 0.08
115 0.09
116 0.09
117 0.1
118 0.1
119 0.14
120 0.14
121 0.15
122 0.15
123 0.14
124 0.13
125 0.12
126 0.13
127 0.09
128 0.09
129 0.1
130 0.11
131 0.11
132 0.11
133 0.1
134 0.09
135 0.08
136 0.08
137 0.05
138 0.04
139 0.04
140 0.05
141 0.05
142 0.06
143 0.05
144 0.05
145 0.06
146 0.1
147 0.12
148 0.15
149 0.16
150 0.24
151 0.33
152 0.39
153 0.45
154 0.49
155 0.56
156 0.63
157 0.73
158 0.74
159 0.75
160 0.76
161 0.8
162 0.81
163 0.79
164 0.79
165 0.76
166 0.73
167 0.68
168 0.64
169 0.56
170 0.5
171 0.44
172 0.35
173 0.28
174 0.21
175 0.18
176 0.15
177 0.13
178 0.1
179 0.08
180 0.08
181 0.07
182 0.06
183 0.05
184 0.06
185 0.05
186 0.06
187 0.06
188 0.06
189 0.06