Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P7ZDF0

Protein Details
Accession A0A2P7ZDF0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
178-197EKEKAAKRERRELRRKAEGGBasic
216-238EKGTGRGRRVKRILEKDAKNIRKBasic
NLS Segment(s)
PositionSequence
179-238KEKAAKRERRELRRKAEGGNEEAKKRVVEEGIAIREVEKGTGRGRRVKRILEKDAKNIRK
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
IPR039193  S17mt  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MASLSTPSSRMAICIARSQCPRPAILAWRNGRRFQTTSTETSSAAPPEPLAATLLSQFPSGPPKTGPSLGTNPTKHHSQLLTGKVTSAGVMSKTVRVDRPIQVWHNYLRKFYKSSKHYLVHDPANSLRKGDMVSFSRLPVPKGEAVGHVVREILVPFGQDIGQRPPVPSLGELKEEFEKEKAAKRERRELRRKAEGGNEEAKKRVVEEGIAIREVEKGTGRGRRVKRILEKDAKNIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.35
4 0.4
5 0.43
6 0.45
7 0.43
8 0.42
9 0.37
10 0.39
11 0.41
12 0.43
13 0.49
14 0.5
15 0.58
16 0.61
17 0.63
18 0.61
19 0.58
20 0.54
21 0.49
22 0.5
23 0.45
24 0.45
25 0.46
26 0.44
27 0.38
28 0.38
29 0.36
30 0.28
31 0.24
32 0.2
33 0.14
34 0.14
35 0.13
36 0.12
37 0.1
38 0.09
39 0.08
40 0.09
41 0.11
42 0.1
43 0.1
44 0.09
45 0.1
46 0.16
47 0.17
48 0.17
49 0.17
50 0.19
51 0.23
52 0.25
53 0.26
54 0.24
55 0.29
56 0.32
57 0.39
58 0.37
59 0.37
60 0.37
61 0.38
62 0.34
63 0.32
64 0.28
65 0.26
66 0.31
67 0.33
68 0.33
69 0.3
70 0.3
71 0.26
72 0.25
73 0.19
74 0.13
75 0.09
76 0.06
77 0.08
78 0.08
79 0.1
80 0.11
81 0.13
82 0.14
83 0.16
84 0.2
85 0.2
86 0.23
87 0.26
88 0.28
89 0.29
90 0.3
91 0.33
92 0.36
93 0.34
94 0.34
95 0.33
96 0.32
97 0.34
98 0.37
99 0.4
100 0.37
101 0.43
102 0.46
103 0.47
104 0.47
105 0.49
106 0.48
107 0.43
108 0.4
109 0.35
110 0.31
111 0.32
112 0.28
113 0.23
114 0.19
115 0.15
116 0.15
117 0.14
118 0.16
119 0.14
120 0.18
121 0.18
122 0.18
123 0.22
124 0.22
125 0.22
126 0.19
127 0.2
128 0.17
129 0.18
130 0.18
131 0.14
132 0.17
133 0.17
134 0.16
135 0.13
136 0.12
137 0.1
138 0.1
139 0.09
140 0.07
141 0.06
142 0.06
143 0.05
144 0.06
145 0.07
146 0.07
147 0.1
148 0.13
149 0.18
150 0.19
151 0.19
152 0.2
153 0.21
154 0.21
155 0.2
156 0.21
157 0.18
158 0.21
159 0.21
160 0.22
161 0.24
162 0.24
163 0.24
164 0.19
165 0.21
166 0.19
167 0.26
168 0.33
169 0.39
170 0.45
171 0.5
172 0.6
173 0.67
174 0.75
175 0.78
176 0.8
177 0.79
178 0.83
179 0.79
180 0.73
181 0.72
182 0.65
183 0.6
184 0.6
185 0.55
186 0.47
187 0.46
188 0.43
189 0.34
190 0.31
191 0.28
192 0.21
193 0.17
194 0.2
195 0.24
196 0.25
197 0.26
198 0.25
199 0.21
200 0.23
201 0.22
202 0.19
203 0.14
204 0.15
205 0.2
206 0.27
207 0.31
208 0.39
209 0.45
210 0.54
211 0.59
212 0.66
213 0.71
214 0.74
215 0.8
216 0.8
217 0.8
218 0.8