Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7ZTT2

Protein Details
Accession A0A2P7ZTT2   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
178-201LVIDRKKKPWTKEESKKHIRSQVEHydrophilic
NLS Segment(s)
PositionSequence
183-186KKKP
Subcellular Location(s) cyto 15.5, cyto_nucl 11.5, mito 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011330  Glyco_hydro/deAcase_b/a-brl  
IPR005501  LamB/YcsF/PxpA-like  
Gene Ontology GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF03746  LamB_YcsF  
Amino Acid Sequences MGKIRQQVKINVDLGEGYGNFKCGPDDELLPLIDHANVACGFHAGDPLIMQETVRSCKKAGIAIGAHPGLPDIQGFGRREIKMSPEELTAMVRYQVGALKGFLDAEGVELHHVKPHGVLYGMMYRDIEICRAVYSGVPSGIRVFGLAGTFHEQVAKELGLPFTAELYGDVKYNKDKTLVIDRKKKPWTKEESKKHIRSQVENSSVTAVTGEEIELPIGGNEVSLCCHSDSPGAIDIVKAAREIVDQFNASL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.2
4 0.15
5 0.13
6 0.14
7 0.13
8 0.13
9 0.14
10 0.12
11 0.15
12 0.14
13 0.16
14 0.17
15 0.19
16 0.2
17 0.19
18 0.19
19 0.16
20 0.14
21 0.12
22 0.09
23 0.1
24 0.09
25 0.09
26 0.08
27 0.08
28 0.09
29 0.09
30 0.1
31 0.07
32 0.07
33 0.07
34 0.08
35 0.09
36 0.09
37 0.08
38 0.09
39 0.12
40 0.17
41 0.2
42 0.21
43 0.19
44 0.22
45 0.25
46 0.26
47 0.24
48 0.25
49 0.24
50 0.24
51 0.28
52 0.25
53 0.23
54 0.2
55 0.18
56 0.12
57 0.11
58 0.09
59 0.06
60 0.07
61 0.13
62 0.14
63 0.18
64 0.24
65 0.23
66 0.25
67 0.24
68 0.27
69 0.24
70 0.25
71 0.22
72 0.17
73 0.17
74 0.16
75 0.16
76 0.13
77 0.11
78 0.1
79 0.08
80 0.07
81 0.07
82 0.09
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.08
89 0.07
90 0.06
91 0.05
92 0.05
93 0.05
94 0.04
95 0.05
96 0.06
97 0.06
98 0.07
99 0.08
100 0.07
101 0.07
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.11
108 0.12
109 0.11
110 0.1
111 0.1
112 0.11
113 0.11
114 0.1
115 0.06
116 0.06
117 0.06
118 0.07
119 0.07
120 0.06
121 0.07
122 0.07
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.08
129 0.06
130 0.06
131 0.05
132 0.05
133 0.05
134 0.06
135 0.1
136 0.1
137 0.1
138 0.11
139 0.11
140 0.11
141 0.13
142 0.12
143 0.08
144 0.09
145 0.09
146 0.08
147 0.08
148 0.08
149 0.06
150 0.06
151 0.06
152 0.05
153 0.06
154 0.07
155 0.08
156 0.08
157 0.09
158 0.14
159 0.16
160 0.16
161 0.17
162 0.18
163 0.21
164 0.32
165 0.39
166 0.44
167 0.52
168 0.55
169 0.63
170 0.71
171 0.73
172 0.68
173 0.69
174 0.7
175 0.71
176 0.78
177 0.79
178 0.81
179 0.85
180 0.86
181 0.84
182 0.81
183 0.76
184 0.71
185 0.69
186 0.68
187 0.64
188 0.57
189 0.51
190 0.46
191 0.4
192 0.33
193 0.25
194 0.15
195 0.09
196 0.08
197 0.08
198 0.05
199 0.06
200 0.06
201 0.06
202 0.06
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.05
209 0.07
210 0.08
211 0.09
212 0.1
213 0.11
214 0.12
215 0.14
216 0.15
217 0.17
218 0.19
219 0.18
220 0.17
221 0.16
222 0.18
223 0.17
224 0.16
225 0.13
226 0.1
227 0.1
228 0.12
229 0.15
230 0.17
231 0.19