Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P8A100

Protein Details
Accession A0A2P8A100    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-59QEQLLKFKKAKESAKRDDRLRRRRTEDKNPKLREERRARNVPABasic
NLS Segment(s)
PositionSequence
12-55NKIKRQEQLLKFKKAKESAKRDDRLRRRRTEDKNPKLREERRAR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR044281  IMP4/RPF1  
Gene Ontology GO:0042134  F:rRNA primary transcript binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MAILKNPREIPNKIKRQEQLLKFKKAKESAKRDDRLRRRRTEDKNPKLREERRARNVPATIDSKRTWDEADGDGDLNLGLAVDLQSIKRRKVDSEENAPKVRKQEAAQADDEEDEEADLDGEKDDDLDSMLGSDSEVDSDGEGTPTEDPKPPRAPSPAPSSATDLNKTPENLQSRFPSLFAPLEHPPKVLVTTSINSRLKAEAQVLTSFFPNSHFVPRNTHFHSHKYSVREIASFASNRQYTCLVILNEDLKRPSGLDVVHLPDGPMFHFSISNWIDAKRLPGHGNDTGHDPELILNGFRTPLGLLTAHLFRTLFPPQPELVGRTVVTLHNQRDYIFVRRHRYVFRDKRQTEKSVQGTDGKPIQGVEDVRTGLQELGPRFTLKLRRIDKGIQRSSGQEWAWKGKSEKVRTRFQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.67
3 0.71
4 0.76
5 0.75
6 0.75
7 0.74
8 0.8
9 0.77
10 0.79
11 0.78
12 0.77
13 0.77
14 0.77
15 0.78
16 0.78
17 0.83
18 0.84
19 0.84
20 0.86
21 0.87
22 0.87
23 0.87
24 0.85
25 0.84
26 0.86
27 0.87
28 0.88
29 0.88
30 0.89
31 0.89
32 0.86
33 0.86
34 0.86
35 0.84
36 0.83
37 0.82
38 0.82
39 0.81
40 0.84
41 0.79
42 0.76
43 0.73
44 0.65
45 0.61
46 0.56
47 0.49
48 0.45
49 0.42
50 0.38
51 0.36
52 0.34
53 0.29
54 0.25
55 0.26
56 0.22
57 0.24
58 0.21
59 0.2
60 0.18
61 0.16
62 0.14
63 0.1
64 0.08
65 0.05
66 0.03
67 0.03
68 0.03
69 0.04
70 0.06
71 0.07
72 0.15
73 0.18
74 0.21
75 0.26
76 0.28
77 0.3
78 0.37
79 0.46
80 0.46
81 0.54
82 0.61
83 0.62
84 0.66
85 0.64
86 0.59
87 0.52
88 0.48
89 0.41
90 0.34
91 0.37
92 0.39
93 0.42
94 0.41
95 0.38
96 0.36
97 0.32
98 0.3
99 0.21
100 0.13
101 0.09
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.04
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.04
120 0.05
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.06
127 0.06
128 0.06
129 0.06
130 0.07
131 0.07
132 0.08
133 0.1
134 0.14
135 0.16
136 0.22
137 0.28
138 0.29
139 0.32
140 0.37
141 0.39
142 0.38
143 0.45
144 0.45
145 0.41
146 0.42
147 0.41
148 0.4
149 0.39
150 0.36
151 0.28
152 0.24
153 0.24
154 0.23
155 0.21
156 0.22
157 0.25
158 0.25
159 0.27
160 0.27
161 0.29
162 0.28
163 0.27
164 0.22
165 0.19
166 0.19
167 0.16
168 0.17
169 0.18
170 0.23
171 0.22
172 0.22
173 0.2
174 0.19
175 0.19
176 0.15
177 0.13
178 0.11
179 0.12
180 0.14
181 0.22
182 0.23
183 0.22
184 0.23
185 0.22
186 0.21
187 0.21
188 0.2
189 0.14
190 0.14
191 0.15
192 0.14
193 0.14
194 0.13
195 0.12
196 0.1
197 0.1
198 0.1
199 0.11
200 0.17
201 0.19
202 0.2
203 0.27
204 0.3
205 0.35
206 0.37
207 0.42
208 0.38
209 0.39
210 0.44
211 0.42
212 0.43
213 0.41
214 0.39
215 0.36
216 0.35
217 0.31
218 0.26
219 0.23
220 0.22
221 0.18
222 0.17
223 0.19
224 0.19
225 0.18
226 0.19
227 0.18
228 0.15
229 0.16
230 0.2
231 0.14
232 0.13
233 0.15
234 0.17
235 0.17
236 0.18
237 0.17
238 0.13
239 0.13
240 0.13
241 0.13
242 0.11
243 0.11
244 0.12
245 0.14
246 0.16
247 0.17
248 0.16
249 0.15
250 0.13
251 0.13
252 0.12
253 0.11
254 0.08
255 0.08
256 0.08
257 0.08
258 0.16
259 0.16
260 0.18
261 0.17
262 0.17
263 0.18
264 0.18
265 0.22
266 0.17
267 0.19
268 0.19
269 0.2
270 0.25
271 0.29
272 0.3
273 0.27
274 0.28
275 0.26
276 0.25
277 0.23
278 0.18
279 0.13
280 0.14
281 0.13
282 0.09
283 0.08
284 0.07
285 0.08
286 0.07
287 0.07
288 0.06
289 0.06
290 0.08
291 0.08
292 0.08
293 0.11
294 0.13
295 0.12
296 0.13
297 0.13
298 0.11
299 0.16
300 0.19
301 0.21
302 0.21
303 0.24
304 0.23
305 0.27
306 0.28
307 0.26
308 0.24
309 0.21
310 0.2
311 0.17
312 0.19
313 0.16
314 0.2
315 0.24
316 0.25
317 0.26
318 0.27
319 0.27
320 0.3
321 0.32
322 0.35
323 0.36
324 0.41
325 0.45
326 0.5
327 0.54
328 0.54
329 0.58
330 0.62
331 0.65
332 0.68
333 0.72
334 0.7
335 0.75
336 0.77
337 0.76
338 0.71
339 0.7
340 0.66
341 0.6
342 0.59
343 0.57
344 0.51
345 0.5
346 0.48
347 0.39
348 0.33
349 0.28
350 0.26
351 0.24
352 0.24
353 0.21
354 0.2
355 0.2
356 0.2
357 0.2
358 0.2
359 0.16
360 0.16
361 0.18
362 0.16
363 0.19
364 0.21
365 0.22
366 0.22
367 0.27
368 0.34
369 0.35
370 0.44
371 0.45
372 0.49
373 0.54
374 0.62
375 0.65
376 0.68
377 0.69
378 0.63
379 0.6
380 0.59
381 0.57
382 0.55
383 0.46
384 0.41
385 0.38
386 0.43
387 0.43
388 0.45
389 0.44
390 0.45
391 0.55
392 0.6
393 0.65
394 0.63