Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2TYR2

Protein Details
Accession Q2TYR2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
213-235DKESKEPKSSEKEVRRKLKESPKBasic
NLS Segment(s)
PositionSequence
218-235EPKSSEKEVRRKLKESPK
Subcellular Location(s) mito 12, nucl 9, cyto_nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR040366  Nab2/ZC3H14  
IPR000571  Znf_CCCH  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0008143  F:poly(A) binding  
GO:1900364  P:negative regulation of mRNA polyadenylation  
GO:0043488  P:regulation of mRNA stability  
Pfam View protein in Pfam  
PF14608  zf-CCCH_2  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MSAFERAKWKTTDGEKFTDTVNRLQNATNLLRGTLRMTREVQLHRMAETNPKMAKEEARETTAETMKANAKPDTCRNGAGCRVIECKYSHPDAEPCRYGAGCTNSNCRFRHPKSRLCRNGAGCRKLGCTFAHPEAPDCRYGVGCTNTLCSFKHPSVPACRDGANCMVDKCKFFHPEVKPCRFGTRCTNKNCTFRHPPPPYTKEPTASAKSMDDKESKEPKSSEKEVRRKLKESPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.47
4 0.47
5 0.45
6 0.39
7 0.35
8 0.37
9 0.34
10 0.34
11 0.34
12 0.35
13 0.34
14 0.34
15 0.31
16 0.25
17 0.24
18 0.23
19 0.22
20 0.24
21 0.22
22 0.23
23 0.23
24 0.25
25 0.27
26 0.33
27 0.36
28 0.36
29 0.38
30 0.37
31 0.33
32 0.33
33 0.31
34 0.33
35 0.33
36 0.35
37 0.3
38 0.3
39 0.32
40 0.31
41 0.34
42 0.31
43 0.35
44 0.32
45 0.32
46 0.32
47 0.31
48 0.34
49 0.32
50 0.27
51 0.2
52 0.2
53 0.23
54 0.25
55 0.26
56 0.24
57 0.24
58 0.27
59 0.33
60 0.37
61 0.33
62 0.33
63 0.32
64 0.34
65 0.35
66 0.34
67 0.29
68 0.25
69 0.27
70 0.25
71 0.26
72 0.23
73 0.24
74 0.24
75 0.25
76 0.24
77 0.23
78 0.27
79 0.29
80 0.33
81 0.3
82 0.27
83 0.26
84 0.25
85 0.23
86 0.22
87 0.22
88 0.21
89 0.21
90 0.28
91 0.32
92 0.38
93 0.38
94 0.39
95 0.43
96 0.44
97 0.53
98 0.52
99 0.56
100 0.6
101 0.71
102 0.73
103 0.69
104 0.71
105 0.65
106 0.69
107 0.68
108 0.61
109 0.52
110 0.45
111 0.42
112 0.37
113 0.33
114 0.24
115 0.2
116 0.21
117 0.21
118 0.23
119 0.21
120 0.22
121 0.23
122 0.23
123 0.21
124 0.17
125 0.16
126 0.13
127 0.13
128 0.16
129 0.15
130 0.14
131 0.14
132 0.16
133 0.17
134 0.18
135 0.18
136 0.17
137 0.2
138 0.2
139 0.25
140 0.25
141 0.29
142 0.36
143 0.4
144 0.39
145 0.35
146 0.37
147 0.31
148 0.31
149 0.31
150 0.24
151 0.21
152 0.19
153 0.22
154 0.21
155 0.22
156 0.22
157 0.24
158 0.26
159 0.27
160 0.35
161 0.39
162 0.48
163 0.57
164 0.61
165 0.59
166 0.57
167 0.65
168 0.57
169 0.54
170 0.54
171 0.55
172 0.56
173 0.59
174 0.67
175 0.66
176 0.73
177 0.72
178 0.69
179 0.69
180 0.68
181 0.72
182 0.7
183 0.7
184 0.72
185 0.75
186 0.74
187 0.72
188 0.69
189 0.62
190 0.6
191 0.6
192 0.55
193 0.49
194 0.44
195 0.39
196 0.41
197 0.4
198 0.4
199 0.37
200 0.35
201 0.42
202 0.49
203 0.48
204 0.49
205 0.48
206 0.51
207 0.55
208 0.6
209 0.61
210 0.63
211 0.71
212 0.74
213 0.83
214 0.83
215 0.78