Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7ZE42

Protein Details
Accession A0A2P7ZE42   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-49LEVPKALPHRRARSRSQPREPESPSRRTRSRSRGSPTRVVSHydrophilic
NLS Segment(s)
PositionSequence
15-95LPHRRARSRSQPREPESPSRRTRSRSRGSPTRVVSHTPANLKSSSPTRGGRKRLSGGTGRRPLGSPPPIRSPPPRSSTPKK
Subcellular Location(s) mito 14, nucl 9, cyto_nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024311  Lipocalin-like  
Pfam View protein in Pfam  
PF13924  Lipocalin_5  
Amino Acid Sequences MPRNSPMFLEVPKALPHRRARSRSQPREPESPSRRTRSRSRGSPTRVVSHTPANLKSSSPTRGGRKRLSGGTGRRPLGSPPPIRSPPPRSSTPKKASVPQLQVQRVDLEPVHPREIFNDLNGDYYTLPPSPSPPPTPKIPLRERLIGAWKLESYIAYPTPSSPLQRAKYPMTKNVTGLIMYTPDGYMSAQMLIPGQQQFNKGPGDDSQWAEAGKRCFAYCGPYFISKDGPNGEEKLRHSFQFCSLPGWIGDVQVRTWRFEEDGDVLVLGSEEPTEVKGDFRIPVLKWRKCRDNSDGTPPPPVPQIKVSGPGEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.49
4 0.55
5 0.63
6 0.68
7 0.71
8 0.77
9 0.84
10 0.86
11 0.87
12 0.87
13 0.83
14 0.85
15 0.83
16 0.82
17 0.78
18 0.77
19 0.75
20 0.73
21 0.74
22 0.71
23 0.75
24 0.75
25 0.77
26 0.77
27 0.78
28 0.79
29 0.8
30 0.82
31 0.77
32 0.74
33 0.66
34 0.61
35 0.55
36 0.51
37 0.49
38 0.45
39 0.43
40 0.38
41 0.37
42 0.33
43 0.34
44 0.33
45 0.31
46 0.31
47 0.35
48 0.42
49 0.49
50 0.57
51 0.59
52 0.61
53 0.63
54 0.61
55 0.6
56 0.58
57 0.58
58 0.6
59 0.61
60 0.55
61 0.51
62 0.48
63 0.45
64 0.46
65 0.46
66 0.41
67 0.38
68 0.45
69 0.47
70 0.51
71 0.56
72 0.55
73 0.54
74 0.54
75 0.57
76 0.57
77 0.63
78 0.69
79 0.69
80 0.7
81 0.65
82 0.66
83 0.68
84 0.68
85 0.65
86 0.6
87 0.62
88 0.55
89 0.53
90 0.47
91 0.4
92 0.32
93 0.27
94 0.22
95 0.16
96 0.19
97 0.21
98 0.23
99 0.21
100 0.21
101 0.21
102 0.25
103 0.23
104 0.17
105 0.17
106 0.14
107 0.15
108 0.15
109 0.15
110 0.11
111 0.11
112 0.12
113 0.09
114 0.1
115 0.08
116 0.11
117 0.14
118 0.17
119 0.22
120 0.24
121 0.27
122 0.3
123 0.37
124 0.39
125 0.44
126 0.46
127 0.48
128 0.48
129 0.49
130 0.46
131 0.42
132 0.43
133 0.36
134 0.31
135 0.25
136 0.2
137 0.17
138 0.16
139 0.14
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.08
146 0.11
147 0.12
148 0.12
149 0.14
150 0.21
151 0.22
152 0.25
153 0.29
154 0.31
155 0.38
156 0.39
157 0.43
158 0.41
159 0.41
160 0.38
161 0.36
162 0.32
163 0.24
164 0.22
165 0.15
166 0.1
167 0.09
168 0.09
169 0.07
170 0.06
171 0.06
172 0.06
173 0.06
174 0.05
175 0.05
176 0.05
177 0.05
178 0.06
179 0.06
180 0.08
181 0.09
182 0.1
183 0.11
184 0.14
185 0.14
186 0.17
187 0.18
188 0.16
189 0.15
190 0.16
191 0.2
192 0.21
193 0.21
194 0.19
195 0.19
196 0.19
197 0.19
198 0.22
199 0.17
200 0.16
201 0.16
202 0.15
203 0.15
204 0.16
205 0.21
206 0.19
207 0.21
208 0.22
209 0.26
210 0.27
211 0.26
212 0.31
213 0.26
214 0.27
215 0.25
216 0.24
217 0.22
218 0.23
219 0.25
220 0.25
221 0.26
222 0.31
223 0.31
224 0.31
225 0.31
226 0.3
227 0.32
228 0.35
229 0.34
230 0.29
231 0.28
232 0.27
233 0.25
234 0.27
235 0.22
236 0.16
237 0.18
238 0.15
239 0.15
240 0.2
241 0.21
242 0.21
243 0.21
244 0.21
245 0.2
246 0.2
247 0.22
248 0.18
249 0.19
250 0.17
251 0.16
252 0.14
253 0.12
254 0.12
255 0.08
256 0.06
257 0.04
258 0.04
259 0.04
260 0.05
261 0.07
262 0.07
263 0.08
264 0.1
265 0.12
266 0.13
267 0.16
268 0.2
269 0.2
270 0.3
271 0.4
272 0.45
273 0.52
274 0.6
275 0.68
276 0.7
277 0.77
278 0.75
279 0.75
280 0.74
281 0.76
282 0.76
283 0.67
284 0.68
285 0.6
286 0.54
287 0.51
288 0.47
289 0.4
290 0.35
291 0.4
292 0.36
293 0.44