Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7ZKG3

Protein Details
Accession A0A2P7ZKG3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGQTHNRKRTRSRPRSRNPNYLRDFSHydrophilic
NLS Segment(s)
PositionSequence
11-13RSR
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MGQTHNRKRTRSRPRSRNPNYLRDFSSMSAPYSYSMPPPPPISATVSTPPTLPPRPHRSTSIYSTTSSSWSDQTISPLDSNPISMGTEFRPTPTAPRAFYQHNAPTTTISKRRQRKESGDPAVESAAKRKRIFGSDTGDEEGELCGPMLKVVWDLFEGYDYEDTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.94
3 0.93
4 0.93
5 0.89
6 0.89
7 0.84
8 0.78
9 0.71
10 0.63
11 0.56
12 0.46
13 0.45
14 0.36
15 0.31
16 0.26
17 0.23
18 0.2
19 0.19
20 0.19
21 0.15
22 0.17
23 0.18
24 0.21
25 0.23
26 0.23
27 0.23
28 0.24
29 0.26
30 0.24
31 0.25
32 0.26
33 0.26
34 0.25
35 0.23
36 0.24
37 0.25
38 0.28
39 0.28
40 0.33
41 0.4
42 0.46
43 0.48
44 0.5
45 0.51
46 0.51
47 0.52
48 0.5
49 0.43
50 0.38
51 0.37
52 0.33
53 0.29
54 0.25
55 0.2
56 0.14
57 0.13
58 0.14
59 0.12
60 0.14
61 0.13
62 0.13
63 0.12
64 0.12
65 0.12
66 0.11
67 0.1
68 0.08
69 0.07
70 0.06
71 0.06
72 0.07
73 0.07
74 0.1
75 0.1
76 0.1
77 0.12
78 0.12
79 0.15
80 0.2
81 0.22
82 0.21
83 0.23
84 0.26
85 0.27
86 0.28
87 0.31
88 0.31
89 0.3
90 0.31
91 0.29
92 0.29
93 0.29
94 0.33
95 0.34
96 0.37
97 0.43
98 0.51
99 0.59
100 0.64
101 0.69
102 0.71
103 0.74
104 0.77
105 0.76
106 0.7
107 0.63
108 0.56
109 0.5
110 0.43
111 0.33
112 0.3
113 0.28
114 0.32
115 0.32
116 0.35
117 0.37
118 0.4
119 0.44
120 0.43
121 0.44
122 0.41
123 0.44
124 0.41
125 0.37
126 0.32
127 0.28
128 0.22
129 0.15
130 0.11
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.09
138 0.09
139 0.1
140 0.1
141 0.11
142 0.11
143 0.12
144 0.12
145 0.12