Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P8AJP4

Protein Details
Accession A0A2P8AJP4   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
208-247DGEVKAEEPKKKRKRGPKAPNPLSVKKTVKKDDQRGPKAABasic
NLS Segment(s)
PositionSequence
175-192KVRAGVKRGKGGGEKRKR
215-271EPKKKRKRGPKAPNPLSVKKTVKKDDQRGPKAAMPDRIEKQIRAAREEAKREKAQRA
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
IPR029060  PIN-like_dom_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04900  Fcf1  
CDD cd09865  PIN_ScUtp23p-like  
Amino Acid Sequences MRGKRSKQYRKLMHQYSLAFNFREPYQVLLDAEIIQDTTRFKMDLPHLLSRTLHGQVKPMITQCCIRHLYLSTTEDKTEKSAWIETAKGCERRRCGHHELEEPLSAEECMMSVVDPKGSATNKHRYIVACQDSGLRKKLRAIPGVPLVYVQRSVMVMEPIGQKSEEVKEGLEAEKVRAGVKRGKGGGEKRKREGSEDLDEDEADEDVDGEVKAEEPKKKRKRGPKAPNPLSVKKTVKKDDQRGPKAAMPDRIEKQIRAAREEAKREKAQRANGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.73
3 0.7
4 0.66
5 0.59
6 0.48
7 0.41
8 0.38
9 0.32
10 0.32
11 0.25
12 0.21
13 0.21
14 0.23
15 0.22
16 0.2
17 0.21
18 0.17
19 0.17
20 0.14
21 0.11
22 0.08
23 0.09
24 0.09
25 0.1
26 0.11
27 0.11
28 0.11
29 0.18
30 0.23
31 0.3
32 0.34
33 0.4
34 0.4
35 0.42
36 0.42
37 0.36
38 0.36
39 0.32
40 0.31
41 0.24
42 0.27
43 0.29
44 0.32
45 0.32
46 0.32
47 0.29
48 0.27
49 0.32
50 0.29
51 0.33
52 0.32
53 0.3
54 0.28
55 0.28
56 0.3
57 0.3
58 0.32
59 0.29
60 0.28
61 0.29
62 0.28
63 0.26
64 0.25
65 0.21
66 0.19
67 0.17
68 0.18
69 0.18
70 0.19
71 0.21
72 0.18
73 0.23
74 0.27
75 0.32
76 0.34
77 0.37
78 0.4
79 0.45
80 0.5
81 0.52
82 0.53
83 0.53
84 0.55
85 0.55
86 0.54
87 0.5
88 0.45
89 0.38
90 0.32
91 0.24
92 0.18
93 0.12
94 0.09
95 0.06
96 0.05
97 0.04
98 0.03
99 0.05
100 0.05
101 0.06
102 0.06
103 0.06
104 0.1
105 0.11
106 0.15
107 0.19
108 0.28
109 0.3
110 0.31
111 0.33
112 0.31
113 0.33
114 0.38
115 0.35
116 0.26
117 0.24
118 0.27
119 0.28
120 0.3
121 0.31
122 0.24
123 0.21
124 0.26
125 0.32
126 0.33
127 0.34
128 0.32
129 0.31
130 0.36
131 0.36
132 0.31
133 0.25
134 0.21
135 0.17
136 0.16
137 0.12
138 0.07
139 0.06
140 0.07
141 0.07
142 0.07
143 0.06
144 0.08
145 0.11
146 0.11
147 0.11
148 0.11
149 0.1
150 0.12
151 0.14
152 0.13
153 0.1
154 0.1
155 0.1
156 0.12
157 0.12
158 0.13
159 0.12
160 0.11
161 0.12
162 0.13
163 0.13
164 0.14
165 0.16
166 0.2
167 0.23
168 0.28
169 0.27
170 0.3
171 0.35
172 0.42
173 0.5
174 0.54
175 0.57
176 0.57
177 0.63
178 0.61
179 0.59
180 0.56
181 0.51
182 0.48
183 0.44
184 0.41
185 0.34
186 0.33
187 0.29
188 0.23
189 0.16
190 0.09
191 0.07
192 0.05
193 0.04
194 0.05
195 0.05
196 0.05
197 0.05
198 0.06
199 0.1
200 0.14
201 0.22
202 0.28
203 0.4
204 0.5
205 0.6
206 0.68
207 0.76
208 0.82
209 0.87
210 0.91
211 0.91
212 0.92
213 0.9
214 0.9
215 0.87
216 0.83
217 0.77
218 0.74
219 0.72
220 0.67
221 0.69
222 0.67
223 0.7
224 0.72
225 0.77
226 0.78
227 0.81
228 0.81
229 0.77
230 0.74
231 0.67
232 0.65
233 0.62
234 0.6
235 0.54
236 0.54
237 0.52
238 0.56
239 0.56
240 0.48
241 0.51
242 0.48
243 0.46
244 0.43
245 0.44
246 0.43
247 0.49
248 0.58
249 0.57
250 0.61
251 0.66
252 0.66
253 0.72
254 0.71
255 0.72