Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7YRA1

Protein Details
Accession A0A2P7YRA1    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
108-134ANEGRLKTKKFKSEKKSSRRSSGRSDYHydrophilic
NLS Segment(s)
PositionSequence
108-129ANEGRLKTKKFKSEKKSSRRSS
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MFDFSFSRSSGPGGQNVNKVNSKATLKVSLSSLQPVVPKLLWPIVANSRYATSNELVIQADDSRKQQENVQRCLLKLNELIVQAGREAVPGETSEAQKSRVKNLQKSANEGRLKTKKFKSEKKSSRRSSGRSDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.42
4 0.45
5 0.41
6 0.4
7 0.36
8 0.36
9 0.34
10 0.32
11 0.33
12 0.34
13 0.32
14 0.33
15 0.33
16 0.31
17 0.29
18 0.27
19 0.24
20 0.19
21 0.19
22 0.18
23 0.18
24 0.15
25 0.15
26 0.14
27 0.15
28 0.15
29 0.14
30 0.16
31 0.2
32 0.21
33 0.21
34 0.2
35 0.2
36 0.19
37 0.19
38 0.18
39 0.12
40 0.12
41 0.12
42 0.13
43 0.11
44 0.1
45 0.1
46 0.09
47 0.09
48 0.09
49 0.1
50 0.13
51 0.14
52 0.14
53 0.18
54 0.24
55 0.3
56 0.33
57 0.38
58 0.35
59 0.34
60 0.37
61 0.33
62 0.29
63 0.23
64 0.2
65 0.17
66 0.16
67 0.16
68 0.13
69 0.13
70 0.1
71 0.1
72 0.08
73 0.05
74 0.06
75 0.05
76 0.05
77 0.06
78 0.08
79 0.1
80 0.11
81 0.14
82 0.15
83 0.18
84 0.21
85 0.23
86 0.27
87 0.32
88 0.39
89 0.43
90 0.51
91 0.57
92 0.56
93 0.62
94 0.63
95 0.65
96 0.62
97 0.56
98 0.58
99 0.58
100 0.6
101 0.61
102 0.62
103 0.63
104 0.68
105 0.77
106 0.77
107 0.79
108 0.85
109 0.87
110 0.9
111 0.89
112 0.89
113 0.89
114 0.85