Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2M2V1

Protein Details
Accession E2M2V1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-88RTLSRSRTKSLKAKKGGKRPDIDTHydrophilic
NLS Segment(s)
PositionSequence
69-83RSRTKSLKAKKGGKR
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
KEGG mpr:MPER_14420  -  
Amino Acid Sequences PSTWRREEERAMVLPDPKPVEKPATNLTPPVPSLARVLEEGQILEHQRKKWQTQAINSFQNERARTLSRSRTKSLKAKKGGKRPDIDTPAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.34
4 0.29
5 0.28
6 0.28
7 0.32
8 0.3
9 0.33
10 0.34
11 0.36
12 0.36
13 0.35
14 0.34
15 0.29
16 0.28
17 0.26
18 0.21
19 0.15
20 0.16
21 0.14
22 0.14
23 0.13
24 0.14
25 0.12
26 0.12
27 0.11
28 0.09
29 0.1
30 0.1
31 0.13
32 0.15
33 0.15
34 0.2
35 0.23
36 0.25
37 0.3
38 0.37
39 0.39
40 0.44
41 0.52
42 0.53
43 0.56
44 0.54
45 0.51
46 0.48
47 0.48
48 0.41
49 0.34
50 0.32
51 0.29
52 0.32
53 0.35
54 0.41
55 0.44
56 0.49
57 0.52
58 0.55
59 0.6
60 0.66
61 0.7
62 0.7
63 0.71
64 0.76
65 0.81
66 0.84
67 0.86
68 0.85
69 0.82
70 0.77
71 0.77