Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P8A5F0

Protein Details
Accession A0A2P8A5F0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
252-284SEPMRIMEKTKRRQRHTRHVKSKHKYTVLRIKEBasic
NLS Segment(s)
PositionSequence
260-276KTKRRQRHTRHVKSKHK
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
Amino Acid Sequences MLSRSLRRAVLDTRWTPPTFLCPWTASLTTESHTSTSSNIPPSSLGSSQSASAQSQTQTPLQTSSAISADSQDQDATSTSSTRLPAPPSSPGPKSTTPPALSSSVCTLLPLLQSQRQIYVTAHIHARPYLVTQGDTVRLPFLMPGVQPGDILRLNRATTIGSRDFTLRAPGTERRGKSGTAGTQMVVDPTPASTASSTSRVMASNASASLGNAEEQSATPTEHFVPHLAKGRTKYLDDRLFVCRAVVMGTESEPMRIMEKTKRRQRHTRHVKSKHKYTVLRIKEVRVRGVEEVESGELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.46
4 0.41
5 0.4
6 0.34
7 0.33
8 0.32
9 0.27
10 0.29
11 0.33
12 0.33
13 0.27
14 0.26
15 0.26
16 0.23
17 0.24
18 0.22
19 0.18
20 0.18
21 0.16
22 0.16
23 0.2
24 0.23
25 0.26
26 0.24
27 0.24
28 0.24
29 0.26
30 0.29
31 0.24
32 0.22
33 0.19
34 0.2
35 0.2
36 0.21
37 0.2
38 0.17
39 0.17
40 0.17
41 0.15
42 0.17
43 0.19
44 0.2
45 0.19
46 0.2
47 0.2
48 0.19
49 0.2
50 0.18
51 0.17
52 0.15
53 0.14
54 0.13
55 0.12
56 0.13
57 0.12
58 0.12
59 0.1
60 0.1
61 0.1
62 0.11
63 0.11
64 0.09
65 0.09
66 0.09
67 0.12
68 0.13
69 0.15
70 0.17
71 0.19
72 0.21
73 0.23
74 0.27
75 0.3
76 0.35
77 0.34
78 0.34
79 0.37
80 0.36
81 0.37
82 0.37
83 0.39
84 0.35
85 0.35
86 0.35
87 0.32
88 0.3
89 0.28
90 0.25
91 0.19
92 0.17
93 0.16
94 0.13
95 0.11
96 0.12
97 0.12
98 0.12
99 0.14
100 0.16
101 0.17
102 0.18
103 0.18
104 0.18
105 0.17
106 0.2
107 0.18
108 0.17
109 0.19
110 0.18
111 0.18
112 0.16
113 0.17
114 0.11
115 0.11
116 0.12
117 0.11
118 0.1
119 0.1
120 0.11
121 0.13
122 0.12
123 0.11
124 0.09
125 0.08
126 0.08
127 0.07
128 0.06
129 0.06
130 0.05
131 0.07
132 0.08
133 0.08
134 0.08
135 0.08
136 0.1
137 0.1
138 0.1
139 0.1
140 0.1
141 0.11
142 0.11
143 0.11
144 0.09
145 0.09
146 0.14
147 0.15
148 0.13
149 0.14
150 0.15
151 0.15
152 0.15
153 0.18
154 0.13
155 0.12
156 0.16
157 0.19
158 0.25
159 0.3
160 0.3
161 0.31
162 0.32
163 0.31
164 0.3
165 0.31
166 0.27
167 0.25
168 0.25
169 0.2
170 0.19
171 0.19
172 0.17
173 0.12
174 0.1
175 0.06
176 0.06
177 0.07
178 0.06
179 0.06
180 0.06
181 0.08
182 0.1
183 0.12
184 0.13
185 0.13
186 0.14
187 0.14
188 0.14
189 0.13
190 0.12
191 0.1
192 0.1
193 0.1
194 0.09
195 0.08
196 0.08
197 0.08
198 0.08
199 0.06
200 0.07
201 0.06
202 0.06
203 0.08
204 0.08
205 0.09
206 0.08
207 0.1
208 0.11
209 0.12
210 0.13
211 0.13
212 0.14
213 0.18
214 0.26
215 0.27
216 0.29
217 0.31
218 0.37
219 0.39
220 0.4
221 0.41
222 0.42
223 0.47
224 0.45
225 0.45
226 0.43
227 0.41
228 0.38
229 0.32
230 0.23
231 0.16
232 0.15
233 0.13
234 0.1
235 0.09
236 0.09
237 0.12
238 0.12
239 0.12
240 0.12
241 0.12
242 0.13
243 0.13
244 0.16
245 0.23
246 0.33
247 0.44
248 0.53
249 0.63
250 0.69
251 0.79
252 0.86
253 0.87
254 0.89
255 0.9
256 0.91
257 0.92
258 0.94
259 0.94
260 0.94
261 0.92
262 0.9
263 0.85
264 0.84
265 0.83
266 0.8
267 0.8
268 0.72
269 0.7
270 0.68
271 0.66
272 0.63
273 0.55
274 0.52
275 0.44
276 0.45
277 0.38
278 0.31
279 0.29