Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2U328

Protein Details
Accession Q2U328    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
100-125KSSLTASTSWWKRRRQRGKSNGALLAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, mito 1, pero 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEPSVSDFKLVGLAAGFTLGFGFLTVWNAIKQTSEIEKPYKSPFVILIWIEILSNVVIGVMGWLVLEGIVPVIANTVPPVHLYWRFYYSAGPSRSNVVCKSSLTASTSWWKRRRQRGKSNGALLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.05
10 0.04
11 0.07
12 0.07
13 0.08
14 0.09
15 0.09
16 0.09
17 0.09
18 0.1
19 0.11
20 0.15
21 0.17
22 0.2
23 0.23
24 0.24
25 0.27
26 0.3
27 0.3
28 0.26
29 0.24
30 0.22
31 0.2
32 0.22
33 0.19
34 0.16
35 0.13
36 0.13
37 0.11
38 0.1
39 0.08
40 0.05
41 0.04
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.05
66 0.06
67 0.09
68 0.12
69 0.15
70 0.17
71 0.2
72 0.21
73 0.21
74 0.22
75 0.23
76 0.29
77 0.29
78 0.29
79 0.26
80 0.3
81 0.32
82 0.34
83 0.31
84 0.27
85 0.25
86 0.24
87 0.27
88 0.24
89 0.24
90 0.23
91 0.22
92 0.22
93 0.3
94 0.37
95 0.44
96 0.49
97 0.56
98 0.63
99 0.74
100 0.81
101 0.83
102 0.86
103 0.87
104 0.91
105 0.91