Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P7ZAJ0

Protein Details
Accession A0A2P7ZAJ0    Localization Confidence High Confidence Score 24
NoLS Segment(s)
PositionSequenceProtein Nature
270-290SMENRKKSRIEKERQQNVIREHydrophilic
324-356GMKSKDREKAIDKKRKKEAQKEKKAMPAPRRIVBasic
NLS Segment(s)
PositionSequence
118-153KQAKAAEGKRSSKKSSAEKSITKKAKEERASAKKAK
273-283NRKKSRIEKER
326-355KSKDREKAIDKKRKKEAQKEKKAMPAPRRI
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MPGKKRLEKPVRPRVDDLMEDVSEDGADNNVEEGSSPSMLNTGEGGDVLSSGDEDGEDGSDMSGNEEVEPEDHLKSVSFGTLAKAQDSLSLKRKRNSDSNPQQEAKMDALRARLNEIKQAKAAEGKRSSKKSSAEKSITKKAKEERASAKKAKVEARADDSGDSEENDSDSSSSDQDEDGPQKSRTSKHAPASQSSKYQVTRKREVVEVPKRNVRDPRFGLPGRVDEDKIGRAYSFIHDYEDKEMDELRAAIKKTKDEDEKYKLRRHLMSMENRKKSRIEKERQQNVIREHRKAEKQAIHEGKQPYYLKRSDIKQQALVNKFEGMKSKDREKAIDKKRKKEAQKEKKAMPAPRRIVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.71
3 0.62
4 0.55
5 0.5
6 0.39
7 0.34
8 0.3
9 0.23
10 0.17
11 0.15
12 0.11
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.08
21 0.1
22 0.11
23 0.11
24 0.1
25 0.12
26 0.12
27 0.12
28 0.1
29 0.09
30 0.08
31 0.08
32 0.08
33 0.06
34 0.06
35 0.06
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.07
48 0.07
49 0.08
50 0.09
51 0.08
52 0.08
53 0.09
54 0.09
55 0.08
56 0.1
57 0.11
58 0.11
59 0.11
60 0.11
61 0.1
62 0.11
63 0.11
64 0.1
65 0.08
66 0.08
67 0.1
68 0.15
69 0.16
70 0.15
71 0.15
72 0.15
73 0.2
74 0.23
75 0.26
76 0.31
77 0.39
78 0.44
79 0.48
80 0.54
81 0.54
82 0.6
83 0.62
84 0.64
85 0.66
86 0.7
87 0.73
88 0.68
89 0.63
90 0.55
91 0.5
92 0.41
93 0.33
94 0.24
95 0.18
96 0.21
97 0.22
98 0.21
99 0.23
100 0.24
101 0.22
102 0.29
103 0.3
104 0.28
105 0.28
106 0.28
107 0.25
108 0.28
109 0.3
110 0.3
111 0.35
112 0.41
113 0.46
114 0.51
115 0.53
116 0.52
117 0.56
118 0.57
119 0.57
120 0.59
121 0.58
122 0.6
123 0.63
124 0.67
125 0.67
126 0.59
127 0.57
128 0.54
129 0.57
130 0.54
131 0.54
132 0.55
133 0.58
134 0.64
135 0.63
136 0.6
137 0.54
138 0.55
139 0.53
140 0.5
141 0.44
142 0.39
143 0.41
144 0.38
145 0.36
146 0.31
147 0.27
148 0.2
149 0.17
150 0.14
151 0.09
152 0.08
153 0.07
154 0.07
155 0.06
156 0.05
157 0.06
158 0.06
159 0.06
160 0.06
161 0.07
162 0.06
163 0.07
164 0.09
165 0.1
166 0.11
167 0.14
168 0.14
169 0.16
170 0.19
171 0.2
172 0.25
173 0.31
174 0.36
175 0.39
176 0.45
177 0.45
178 0.47
179 0.5
180 0.47
181 0.42
182 0.38
183 0.35
184 0.32
185 0.37
186 0.4
187 0.41
188 0.46
189 0.46
190 0.46
191 0.44
192 0.46
193 0.49
194 0.53
195 0.53
196 0.5
197 0.51
198 0.5
199 0.53
200 0.56
201 0.5
202 0.48
203 0.45
204 0.46
205 0.49
206 0.48
207 0.46
208 0.4
209 0.39
210 0.32
211 0.3
212 0.25
213 0.19
214 0.21
215 0.2
216 0.19
217 0.16
218 0.13
219 0.11
220 0.12
221 0.13
222 0.15
223 0.13
224 0.15
225 0.16
226 0.18
227 0.21
228 0.21
229 0.19
230 0.16
231 0.16
232 0.13
233 0.13
234 0.12
235 0.1
236 0.13
237 0.14
238 0.18
239 0.2
240 0.23
241 0.26
242 0.34
243 0.39
244 0.42
245 0.49
246 0.53
247 0.6
248 0.63
249 0.67
250 0.64
251 0.63
252 0.6
253 0.56
254 0.55
255 0.55
256 0.59
257 0.63
258 0.68
259 0.71
260 0.69
261 0.67
262 0.64
263 0.62
264 0.62
265 0.62
266 0.62
267 0.63
268 0.73
269 0.8
270 0.83
271 0.81
272 0.77
273 0.75
274 0.76
275 0.72
276 0.65
277 0.61
278 0.61
279 0.63
280 0.62
281 0.63
282 0.58
283 0.57
284 0.63
285 0.65
286 0.6
287 0.6
288 0.58
289 0.5
290 0.51
291 0.5
292 0.45
293 0.44
294 0.43
295 0.42
296 0.45
297 0.47
298 0.49
299 0.55
300 0.55
301 0.54
302 0.58
303 0.62
304 0.6
305 0.58
306 0.5
307 0.45
308 0.41
309 0.36
310 0.38
311 0.34
312 0.38
313 0.41
314 0.48
315 0.51
316 0.53
317 0.58
318 0.58
319 0.64
320 0.66
321 0.71
322 0.72
323 0.75
324 0.82
325 0.86
326 0.88
327 0.88
328 0.89
329 0.89
330 0.92
331 0.91
332 0.87
333 0.87
334 0.85
335 0.83
336 0.81
337 0.8