Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7Z7R2

Protein Details
Accession A0A2P7Z7R2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
29-49VPSSWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
34-51RKPKGIDNRVRRRFKGQA
Subcellular Location(s) mito 19.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVAKKHVPIVKKRTAHFWRHQSDRFKCVPSSWRKPKGIDNRVRRRFKGQAAMPKIGYGSNKKTRHLMPSGHKAFVVNNVQDVELLLMHNRTFAAEIASAVSSRKRIEIVARAKQLGVKVTNGKAKLTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.68
3 0.71
4 0.7
5 0.71
6 0.7
7 0.72
8 0.78
9 0.77
10 0.74
11 0.72
12 0.67
13 0.6
14 0.53
15 0.49
16 0.51
17 0.51
18 0.56
19 0.59
20 0.64
21 0.64
22 0.66
23 0.72
24 0.73
25 0.74
26 0.73
27 0.73
28 0.75
29 0.81
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.43
42 0.38
43 0.3
44 0.27
45 0.22
46 0.24
47 0.31
48 0.33
49 0.34
50 0.37
51 0.38
52 0.41
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.31
63 0.29
64 0.19
65 0.17
66 0.17
67 0.17
68 0.17
69 0.16
70 0.1
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.08
82 0.08
83 0.08
84 0.09
85 0.1
86 0.09
87 0.09
88 0.11
89 0.11
90 0.12
91 0.13
92 0.12
93 0.14
94 0.2
95 0.29
96 0.36
97 0.42
98 0.46
99 0.45
100 0.45
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37