Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P8ABS8

Protein Details
Accession A0A2P8ABS8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
131-155HKTNVCKVVKKAKPKRPAGTKTGSTHydrophilic
NLS Segment(s)
PositionSequence
140-148KKAKPKRPA
Subcellular Location(s) mito 16, nucl 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MAPPAQQLTYPHKQFASAVRPMMIMNGNIPGPWDRIYETSEEEIRAAFTEYAEGTYMRVPWLVPSERRQARASKTHTNRQHGVISPGLGGSNDSPVPKTTKGYAKTKRSVDMMDDESSVNEDAVQPSTKAHKTNVCKVVKKAKPKRPAGTKTGSTTSNGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.4
4 0.35
5 0.34
6 0.31
7 0.31
8 0.3
9 0.3
10 0.24
11 0.17
12 0.13
13 0.14
14 0.13
15 0.12
16 0.14
17 0.13
18 0.13
19 0.14
20 0.14
21 0.14
22 0.16
23 0.17
24 0.18
25 0.19
26 0.2
27 0.2
28 0.19
29 0.17
30 0.16
31 0.14
32 0.13
33 0.12
34 0.09
35 0.07
36 0.08
37 0.08
38 0.09
39 0.09
40 0.08
41 0.07
42 0.08
43 0.08
44 0.07
45 0.08
46 0.07
47 0.07
48 0.13
49 0.15
50 0.17
51 0.21
52 0.3
53 0.33
54 0.36
55 0.37
56 0.37
57 0.4
58 0.45
59 0.47
60 0.48
61 0.51
62 0.56
63 0.61
64 0.61
65 0.58
66 0.53
67 0.5
68 0.4
69 0.38
70 0.29
71 0.23
72 0.17
73 0.15
74 0.12
75 0.08
76 0.08
77 0.05
78 0.07
79 0.07
80 0.07
81 0.08
82 0.09
83 0.13
84 0.14
85 0.15
86 0.18
87 0.24
88 0.29
89 0.39
90 0.47
91 0.52
92 0.58
93 0.59
94 0.58
95 0.53
96 0.49
97 0.42
98 0.38
99 0.33
100 0.27
101 0.25
102 0.22
103 0.19
104 0.19
105 0.17
106 0.11
107 0.08
108 0.08
109 0.08
110 0.1
111 0.11
112 0.1
113 0.12
114 0.18
115 0.21
116 0.23
117 0.26
118 0.33
119 0.39
120 0.49
121 0.57
122 0.58
123 0.6
124 0.64
125 0.71
126 0.69
127 0.74
128 0.75
129 0.75
130 0.77
131 0.82
132 0.85
133 0.85
134 0.86
135 0.83
136 0.81
137 0.77
138 0.73
139 0.68
140 0.59