Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7ZQ89

Protein Details
Accession A0A2P7ZQ89   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-113PGQRCRATKRSIHKRKKKDKPVKKHVRCDLYSDBasic
NLS Segment(s)
PositionSequence
88-105TKRSIHKRKKKDKPVKKH
Subcellular Location(s) extr 16, mito 3, plas 3, golg 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MKIPFLMPLFALLPLATGAAISSVSTPEYYQNQTSTSPSDLLEARGLYHAYGTCDFPTQTCAIKGAKRPVWCPTEHPCTFPGQRCRATKRSIHKRKKKDKPVKKHVRCDLYSDEYHADN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.06
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.06
12 0.07
13 0.07
14 0.1
15 0.14
16 0.17
17 0.19
18 0.19
19 0.2
20 0.21
21 0.22
22 0.21
23 0.2
24 0.17
25 0.15
26 0.16
27 0.15
28 0.15
29 0.15
30 0.12
31 0.11
32 0.11
33 0.11
34 0.09
35 0.09
36 0.09
37 0.09
38 0.1
39 0.11
40 0.1
41 0.11
42 0.11
43 0.1
44 0.12
45 0.11
46 0.11
47 0.1
48 0.12
49 0.13
50 0.16
51 0.2
52 0.26
53 0.28
54 0.3
55 0.32
56 0.36
57 0.37
58 0.35
59 0.35
60 0.35
61 0.4
62 0.39
63 0.38
64 0.34
65 0.36
66 0.4
67 0.42
68 0.44
69 0.42
70 0.49
71 0.53
72 0.6
73 0.6
74 0.61
75 0.61
76 0.63
77 0.68
78 0.72
79 0.77
80 0.8
81 0.85
82 0.91
83 0.94
84 0.95
85 0.94
86 0.94
87 0.94
88 0.95
89 0.96
90 0.95
91 0.94
92 0.93
93 0.91
94 0.81
95 0.76
96 0.73
97 0.68
98 0.59
99 0.52