Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P8A0T2

Protein Details
Accession A0A2P8A0T2   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
74-96DVTAKKPKKVKERHKTMNSPFNWHydrophilic
NLS Segment(s)
PositionSequence
78-87KKPKKVKERH
Subcellular Location(s) nucl 19, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036573  CBM_sf_5/12  
Gene Ontology GO:0005576  C:extracellular region  
GO:0030246  F:carbohydrate binding  
GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Amino Acid Sequences MVLSSDDPAAHRKQCTLCGTPRDVLIRCQVDDTNKWHMICPGKCWQDVSGGVEDGDGSNPYYRYGGMWKNRHADVTAKKPKKVKERHKTMNSPFNWTDNEHKYTTNDRVLFKGQVWVCRKTHNSSDKEAPDQAIALWKQDDKATVSDGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.45
4 0.47
5 0.49
6 0.53
7 0.49
8 0.49
9 0.47
10 0.42
11 0.39
12 0.4
13 0.36
14 0.32
15 0.33
16 0.31
17 0.3
18 0.33
19 0.34
20 0.34
21 0.35
22 0.35
23 0.33
24 0.36
25 0.4
26 0.37
27 0.38
28 0.38
29 0.38
30 0.38
31 0.39
32 0.35
33 0.31
34 0.31
35 0.29
36 0.22
37 0.18
38 0.17
39 0.16
40 0.15
41 0.1
42 0.09
43 0.07
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.08
51 0.12
52 0.18
53 0.25
54 0.3
55 0.33
56 0.37
57 0.37
58 0.37
59 0.33
60 0.32
61 0.29
62 0.35
63 0.42
64 0.41
65 0.44
66 0.48
67 0.54
68 0.58
69 0.64
70 0.64
71 0.65
72 0.73
73 0.8
74 0.84
75 0.86
76 0.82
77 0.81
78 0.71
79 0.67
80 0.58
81 0.5
82 0.43
83 0.37
84 0.37
85 0.33
86 0.36
87 0.3
88 0.3
89 0.31
90 0.34
91 0.37
92 0.37
93 0.35
94 0.33
95 0.35
96 0.37
97 0.35
98 0.3
99 0.32
100 0.27
101 0.32
102 0.35
103 0.38
104 0.36
105 0.42
106 0.45
107 0.44
108 0.51
109 0.52
110 0.52
111 0.53
112 0.61
113 0.58
114 0.58
115 0.54
116 0.46
117 0.37
118 0.33
119 0.27
120 0.26
121 0.22
122 0.2
123 0.2
124 0.2
125 0.21
126 0.22
127 0.24
128 0.2
129 0.21