Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P7ZUI1

Protein Details
Accession A0A2P7ZUI1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 11, cyto_nucl 9.333, mito_nucl 9.333, mito 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKAQHAVILDKTTSDKLQKDVQSYRLVTVAVLVDRLKINGSLARQAIKDMEEKGQIKKVVGHSRGSIYRLLAASSFEAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.93
8 0.9
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.41
16 0.35
17 0.28
18 0.21
19 0.2
20 0.18
21 0.18
22 0.17
23 0.17
24 0.18
25 0.25
26 0.27
27 0.3
28 0.32
29 0.34
30 0.35
31 0.34
32 0.32
33 0.26
34 0.23
35 0.17
36 0.15
37 0.12
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.07
47 0.09
48 0.1
49 0.13
50 0.14
51 0.15
52 0.15
53 0.16
54 0.16
55 0.15
56 0.16
57 0.14
58 0.16
59 0.21
60 0.22
61 0.25
62 0.3
63 0.29
64 0.28
65 0.31
66 0.37
67 0.41
68 0.42
69 0.42
70 0.39
71 0.44
72 0.46
73 0.42
74 0.36
75 0.27
76 0.29
77 0.26
78 0.24
79 0.19
80 0.18