Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P8AI50

Protein Details
Accession A0A2P8AI50    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
153-184RQRFHERPGLMRKRLKRERWRRHFKEGFKGMVBasic
NLS Segment(s)
PositionSequence
158-192ERPGLMRKRLKRERWRRHFKEGFKGMVALVRKMKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MLDKTLDMDKSTPTSSQGRPSHFASRNAQEENKPESRKESNEPSSQRKGNDNSISDLLAAFSNYRQGQAPRGSTLGNKMDTSKLAYPGNYLDPMGNTRGGAPEQLPLPLPVRLGPNLGRTVKVNPTRNIDVGRAFRQLDIMCNRNRVRADFNRQRFHERPGLMRKRLKRERWRRHFKEGFKGMVALVRKMKKQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.38
4 0.41
5 0.43
6 0.46
7 0.5
8 0.56
9 0.55
10 0.58
11 0.55
12 0.56
13 0.56
14 0.56
15 0.55
16 0.48
17 0.48
18 0.5
19 0.51
20 0.46
21 0.42
22 0.44
23 0.46
24 0.47
25 0.48
26 0.51
27 0.49
28 0.55
29 0.6
30 0.61
31 0.64
32 0.62
33 0.58
34 0.56
35 0.53
36 0.54
37 0.54
38 0.48
39 0.44
40 0.41
41 0.39
42 0.32
43 0.27
44 0.19
45 0.12
46 0.1
47 0.07
48 0.06
49 0.11
50 0.11
51 0.12
52 0.13
53 0.14
54 0.2
55 0.24
56 0.25
57 0.22
58 0.23
59 0.22
60 0.21
61 0.25
62 0.23
63 0.2
64 0.19
65 0.19
66 0.19
67 0.19
68 0.22
69 0.18
70 0.18
71 0.17
72 0.17
73 0.16
74 0.17
75 0.18
76 0.14
77 0.13
78 0.1
79 0.09
80 0.11
81 0.11
82 0.1
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.07
89 0.08
90 0.08
91 0.08
92 0.08
93 0.09
94 0.1
95 0.1
96 0.1
97 0.1
98 0.12
99 0.12
100 0.14
101 0.14
102 0.16
103 0.2
104 0.21
105 0.2
106 0.19
107 0.22
108 0.28
109 0.34
110 0.37
111 0.36
112 0.42
113 0.44
114 0.44
115 0.43
116 0.37
117 0.34
118 0.32
119 0.31
120 0.28
121 0.26
122 0.24
123 0.25
124 0.23
125 0.25
126 0.25
127 0.28
128 0.27
129 0.34
130 0.35
131 0.37
132 0.39
133 0.35
134 0.39
135 0.43
136 0.51
137 0.54
138 0.62
139 0.66
140 0.67
141 0.73
142 0.67
143 0.64
144 0.62
145 0.54
146 0.54
147 0.56
148 0.63
149 0.62
150 0.68
151 0.7
152 0.73
153 0.81
154 0.83
155 0.83
156 0.85
157 0.88
158 0.91
159 0.94
160 0.91
161 0.92
162 0.9
163 0.87
164 0.86
165 0.82
166 0.75
167 0.65
168 0.58
169 0.47
170 0.43
171 0.38
172 0.32
173 0.33
174 0.34
175 0.35