Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P8A0D4

Protein Details
Accession A0A2P8A0D4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-34NQDSEVTRRERRRAEKKRKERENARMRERARBasic
NLS Segment(s)
PositionSequence
11-41RRERRRAEKKRKERENARMRERARVWAERER
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, mito 5
Family & Domain DBs
Amino Acid Sequences MAGNQDSEVTRRERRRAEKKRKERENARMRERARVWAERERREQAERLAEWFAAEDAELERVAEARAERRERERAVATWGAEVRGGRGCWRWDMSPQGVTESGMVFACGEGCESCKEALKATRDEHYKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.7
3 0.78
4 0.84
5 0.87
6 0.9
7 0.93
8 0.94
9 0.94
10 0.93
11 0.93
12 0.92
13 0.9
14 0.87
15 0.85
16 0.76
17 0.74
18 0.66
19 0.64
20 0.59
21 0.55
22 0.52
23 0.53
24 0.6
25 0.57
26 0.61
27 0.58
28 0.55
29 0.53
30 0.5
31 0.45
32 0.44
33 0.37
34 0.33
35 0.29
36 0.25
37 0.22
38 0.19
39 0.15
40 0.07
41 0.07
42 0.05
43 0.04
44 0.05
45 0.05
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.08
53 0.14
54 0.16
55 0.18
56 0.22
57 0.28
58 0.28
59 0.32
60 0.31
61 0.26
62 0.29
63 0.3
64 0.26
65 0.23
66 0.22
67 0.18
68 0.16
69 0.15
70 0.12
71 0.12
72 0.12
73 0.12
74 0.15
75 0.16
76 0.19
77 0.21
78 0.21
79 0.22
80 0.28
81 0.29
82 0.29
83 0.28
84 0.27
85 0.25
86 0.24
87 0.21
88 0.15
89 0.13
90 0.1
91 0.1
92 0.07
93 0.06
94 0.07
95 0.06
96 0.07
97 0.06
98 0.08
99 0.1
100 0.11
101 0.13
102 0.17
103 0.18
104 0.22
105 0.28
106 0.32
107 0.36
108 0.38
109 0.45