Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P8A8X6

Protein Details
Accession A0A2P8A8X6    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-40EQASDAVKKEKREKKHKRRKTEEQLPTPVDTBasic
62-81AKAARKAEKKALKEQKRAAKBasic
NLS Segment(s)
PositionSequence
17-29KKEKREKKHKRRK
59-81RKAAKAARKAEKKALKEQKRAAK
Subcellular Location(s) nucl 18, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR000629  RNA-helicase_DEAD-box_CS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004386  F:helicase activity  
GO:0016787  F:hydrolase activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF00270  DEAD  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS00039  DEAD_ATP_HELICASE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
CDD cd00268  DEADc  
cd18787  SF2_C_DEAD  
Amino Acid Sequences MSKRSRDETEQASDAVKKEKREKKHKRRKTEEQLPTPVDTNGTSSPAGAPVDSDDEAARKAAKAARKAEKKALKEQKRAAKEQEKATDTAELPATVTAAVPPVAEAGEGYQEAVSLSSLSQSEVDDFLKKSQITVLDESKKAPPLRPIVAFEHLQLANNDLKSLFSGFKAPTPIQAAAWPYLLSGRDAIGVAETGSGKTMAFGLPCVQHVNKKSSGKKGDAIRACIVSPTRELALQIHEQMVKLTAPFGLKAACVYGGVNKDAQRETLRGASIIVATPGRLNDYIEEGSISLKKVSFLVLDEADRMLDKGFEPEIRKIASDASGKGRQTLMFTATWPPQVRELAATFMNDPIRVMIGDNATGELRANTRIEQKVEVMDPRAKNDRLLEVLKKHGGPKAQADRALIFCLYKKEAARVEDFVRNRGYKVTGIHGDLTQQRRTEALEAFKTGKVRLLVATDVAARGLDIPAVKLVINYTFPLTADDYVHRIGRTGRAGQTGESITFFTEHEKALAGALVNVLKAANQNVPEDLMKFGTTVKKKAHDVYGAFYKDPGEMKKATKITFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.37
4 0.38
5 0.46
6 0.54
7 0.62
8 0.7
9 0.79
10 0.81
11 0.89
12 0.92
13 0.93
14 0.95
15 0.95
16 0.95
17 0.95
18 0.94
19 0.92
20 0.91
21 0.83
22 0.75
23 0.65
24 0.55
25 0.45
26 0.35
27 0.29
28 0.22
29 0.21
30 0.18
31 0.17
32 0.17
33 0.18
34 0.18
35 0.14
36 0.13
37 0.12
38 0.16
39 0.16
40 0.16
41 0.14
42 0.14
43 0.15
44 0.16
45 0.15
46 0.11
47 0.15
48 0.19
49 0.25
50 0.32
51 0.4
52 0.5
53 0.58
54 0.63
55 0.69
56 0.72
57 0.72
58 0.75
59 0.77
60 0.76
61 0.77
62 0.8
63 0.8
64 0.79
65 0.8
66 0.79
67 0.77
68 0.74
69 0.73
70 0.72
71 0.66
72 0.59
73 0.55
74 0.5
75 0.41
76 0.37
77 0.3
78 0.21
79 0.18
80 0.17
81 0.16
82 0.1
83 0.09
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.05
94 0.07
95 0.07
96 0.07
97 0.06
98 0.07
99 0.07
100 0.07
101 0.06
102 0.05
103 0.05
104 0.07
105 0.07
106 0.08
107 0.08
108 0.08
109 0.1
110 0.11
111 0.12
112 0.13
113 0.14
114 0.16
115 0.2
116 0.19
117 0.18
118 0.2
119 0.23
120 0.24
121 0.28
122 0.34
123 0.35
124 0.36
125 0.37
126 0.37
127 0.39
128 0.37
129 0.36
130 0.35
131 0.35
132 0.39
133 0.4
134 0.41
135 0.39
136 0.4
137 0.38
138 0.32
139 0.32
140 0.27
141 0.25
142 0.21
143 0.2
144 0.19
145 0.19
146 0.18
147 0.12
148 0.12
149 0.12
150 0.14
151 0.12
152 0.09
153 0.13
154 0.13
155 0.16
156 0.21
157 0.2
158 0.21
159 0.24
160 0.24
161 0.21
162 0.23
163 0.22
164 0.19
165 0.19
166 0.16
167 0.12
168 0.13
169 0.13
170 0.11
171 0.09
172 0.08
173 0.08
174 0.08
175 0.08
176 0.07
177 0.06
178 0.06
179 0.06
180 0.06
181 0.05
182 0.06
183 0.06
184 0.05
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.08
191 0.09
192 0.1
193 0.13
194 0.13
195 0.18
196 0.21
197 0.26
198 0.3
199 0.37
200 0.41
201 0.47
202 0.52
203 0.5
204 0.52
205 0.53
206 0.55
207 0.5
208 0.49
209 0.42
210 0.38
211 0.35
212 0.31
213 0.25
214 0.18
215 0.16
216 0.13
217 0.11
218 0.11
219 0.11
220 0.11
221 0.13
222 0.13
223 0.13
224 0.14
225 0.14
226 0.13
227 0.13
228 0.13
229 0.09
230 0.08
231 0.07
232 0.07
233 0.07
234 0.07
235 0.08
236 0.07
237 0.07
238 0.07
239 0.07
240 0.05
241 0.05
242 0.05
243 0.08
244 0.09
245 0.1
246 0.12
247 0.13
248 0.16
249 0.16
250 0.17
251 0.16
252 0.15
253 0.16
254 0.17
255 0.15
256 0.13
257 0.13
258 0.12
259 0.1
260 0.09
261 0.08
262 0.06
263 0.06
264 0.06
265 0.06
266 0.07
267 0.07
268 0.07
269 0.07
270 0.09
271 0.09
272 0.09
273 0.09
274 0.08
275 0.08
276 0.09
277 0.09
278 0.07
279 0.07
280 0.07
281 0.07
282 0.08
283 0.07
284 0.07
285 0.09
286 0.09
287 0.09
288 0.09
289 0.09
290 0.09
291 0.08
292 0.07
293 0.05
294 0.05
295 0.05
296 0.06
297 0.07
298 0.1
299 0.13
300 0.14
301 0.17
302 0.17
303 0.17
304 0.15
305 0.16
306 0.17
307 0.16
308 0.16
309 0.2
310 0.24
311 0.24
312 0.25
313 0.24
314 0.21
315 0.21
316 0.2
317 0.17
318 0.13
319 0.14
320 0.16
321 0.17
322 0.21
323 0.2
324 0.19
325 0.19
326 0.2
327 0.19
328 0.18
329 0.17
330 0.15
331 0.14
332 0.14
333 0.12
334 0.14
335 0.14
336 0.12
337 0.11
338 0.09
339 0.09
340 0.08
341 0.08
342 0.08
343 0.08
344 0.08
345 0.08
346 0.09
347 0.08
348 0.08
349 0.08
350 0.07
351 0.07
352 0.09
353 0.1
354 0.11
355 0.17
356 0.2
357 0.22
358 0.22
359 0.22
360 0.23
361 0.24
362 0.24
363 0.21
364 0.25
365 0.24
366 0.27
367 0.32
368 0.3
369 0.3
370 0.31
371 0.3
372 0.28
373 0.31
374 0.32
375 0.28
376 0.32
377 0.33
378 0.33
379 0.32
380 0.31
381 0.3
382 0.28
383 0.34
384 0.39
385 0.4
386 0.4
387 0.4
388 0.39
389 0.37
390 0.36
391 0.27
392 0.18
393 0.16
394 0.18
395 0.18
396 0.19
397 0.19
398 0.23
399 0.27
400 0.29
401 0.3
402 0.31
403 0.33
404 0.36
405 0.36
406 0.34
407 0.36
408 0.33
409 0.31
410 0.3
411 0.28
412 0.24
413 0.25
414 0.27
415 0.25
416 0.26
417 0.27
418 0.25
419 0.26
420 0.3
421 0.32
422 0.3
423 0.27
424 0.26
425 0.25
426 0.27
427 0.27
428 0.25
429 0.27
430 0.25
431 0.28
432 0.3
433 0.31
434 0.31
435 0.27
436 0.27
437 0.22
438 0.21
439 0.19
440 0.19
441 0.18
442 0.17
443 0.18
444 0.14
445 0.13
446 0.12
447 0.1
448 0.07
449 0.08
450 0.07
451 0.07
452 0.07
453 0.07
454 0.08
455 0.09
456 0.09
457 0.08
458 0.09
459 0.1
460 0.12
461 0.12
462 0.13
463 0.13
464 0.13
465 0.16
466 0.16
467 0.16
468 0.17
469 0.18
470 0.19
471 0.21
472 0.23
473 0.2
474 0.19
475 0.2
476 0.24
477 0.27
478 0.3
479 0.31
480 0.34
481 0.35
482 0.34
483 0.36
484 0.32
485 0.28
486 0.23
487 0.2
488 0.15
489 0.15
490 0.15
491 0.14
492 0.15
493 0.14
494 0.14
495 0.14
496 0.14
497 0.13
498 0.15
499 0.11
500 0.09
501 0.11
502 0.11
503 0.1
504 0.1
505 0.09
506 0.09
507 0.1
508 0.13
509 0.15
510 0.16
511 0.18
512 0.19
513 0.22
514 0.22
515 0.21
516 0.2
517 0.18
518 0.16
519 0.15
520 0.18
521 0.25
522 0.29
523 0.34
524 0.39
525 0.44
526 0.49
527 0.55
528 0.58
529 0.56
530 0.53
531 0.54
532 0.56
533 0.52
534 0.48
535 0.43
536 0.36
537 0.32
538 0.34
539 0.31
540 0.27
541 0.29
542 0.32
543 0.41
544 0.46