Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7ZUK1

Protein Details
Accession A0A2P7ZUK1   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
166-186VSKGELKKRRERDVRVAKEKVBasic
222-241PVRELCEKAKGQRKKRKPGQBasic
NLS Segment(s)
PositionSequence
172-183KKRRERDVRVAK
229-241KAKGQRKKRKPGQ
Subcellular Location(s) nucl 10, mito 5.5, cyto_mito 5, plas 4, cyto 3.5, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
Amino Acid Sequences MAEVRRRGPADKSINSKIREEDDNKPIKNSISFLDILRILGGIALLNTALSYYITGDAIAWGVRPWWVKPGRLQGWLNGPLQLTDQELAAYDGSDPAKPIYLALNGTIYDVSVGRNYYGPGGMYGFFSGKDASRAFITGCFDTDLTPDMRGIEEMYIPLEDEEEQVSKGELKKRRERDVRVAKEKVRQGIEGWARVFKGETGKNYFEVGKVKREEGWLEKMPVRELCEKAKGQRKKRKPGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.64
3 0.63
4 0.57
5 0.52
6 0.53
7 0.5
8 0.48
9 0.51
10 0.57
11 0.54
12 0.53
13 0.5
14 0.44
15 0.42
16 0.35
17 0.27
18 0.23
19 0.23
20 0.21
21 0.23
22 0.21
23 0.19
24 0.17
25 0.15
26 0.1
27 0.09
28 0.08
29 0.05
30 0.04
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.06
47 0.05
48 0.05
49 0.05
50 0.08
51 0.09
52 0.1
53 0.18
54 0.21
55 0.23
56 0.29
57 0.39
58 0.4
59 0.46
60 0.46
61 0.4
62 0.44
63 0.46
64 0.41
65 0.33
66 0.29
67 0.22
68 0.22
69 0.19
70 0.13
71 0.09
72 0.09
73 0.07
74 0.07
75 0.08
76 0.07
77 0.06
78 0.05
79 0.07
80 0.07
81 0.08
82 0.08
83 0.07
84 0.08
85 0.08
86 0.08
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.07
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.07
105 0.07
106 0.07
107 0.06
108 0.07
109 0.06
110 0.06
111 0.07
112 0.06
113 0.06
114 0.07
115 0.07
116 0.06
117 0.08
118 0.08
119 0.09
120 0.09
121 0.09
122 0.09
123 0.11
124 0.13
125 0.1
126 0.11
127 0.11
128 0.1
129 0.1
130 0.1
131 0.1
132 0.09
133 0.09
134 0.08
135 0.08
136 0.08
137 0.08
138 0.08
139 0.07
140 0.06
141 0.06
142 0.07
143 0.06
144 0.06
145 0.06
146 0.06
147 0.05
148 0.06
149 0.07
150 0.07
151 0.07
152 0.07
153 0.08
154 0.1
155 0.14
156 0.21
157 0.27
158 0.35
159 0.44
160 0.51
161 0.62
162 0.68
163 0.71
164 0.75
165 0.79
166 0.81
167 0.8
168 0.79
169 0.73
170 0.72
171 0.69
172 0.65
173 0.56
174 0.47
175 0.39
176 0.42
177 0.42
178 0.39
179 0.36
180 0.31
181 0.29
182 0.28
183 0.27
184 0.2
185 0.23
186 0.23
187 0.28
188 0.32
189 0.34
190 0.35
191 0.37
192 0.35
193 0.31
194 0.34
195 0.32
196 0.33
197 0.34
198 0.34
199 0.34
200 0.37
201 0.39
202 0.37
203 0.42
204 0.38
205 0.4
206 0.42
207 0.42
208 0.43
209 0.41
210 0.4
211 0.39
212 0.38
213 0.4
214 0.44
215 0.46
216 0.51
217 0.59
218 0.63
219 0.67
220 0.75
221 0.8