Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7ZDB9

Protein Details
Accession A0A2P7ZDB9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-34QVNVPKTRRTYCKGKDCKKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MSPQVNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVQCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.77
4 0.8
5 0.83
6 0.83
7 0.87
8 0.87
9 0.88
10 0.87
11 0.87
12 0.85
13 0.86
14 0.88
15 0.81
16 0.8
17 0.74
18 0.69
19 0.61
20 0.55
21 0.44
22 0.36
23 0.34
24 0.33
25 0.32
26 0.28
27 0.34
28 0.37
29 0.42
30 0.47
31 0.51
32 0.48
33 0.54
34 0.61
35 0.59
36 0.6
37 0.58
38 0.58
39 0.56
40 0.58
41 0.49
42 0.44
43 0.4
44 0.33
45 0.35
46 0.37
47 0.35
48 0.3
49 0.37
50 0.41
51 0.5
52 0.59
53 0.62
54 0.61
55 0.65
56 0.72
57 0.72
58 0.71
59 0.66
60 0.62
61 0.61
62 0.62
63 0.59
64 0.53
65 0.49
66 0.44
67 0.41
68 0.38
69 0.36
70 0.36
71 0.39
72 0.43
73 0.48
74 0.57
75 0.63
76 0.66
77 0.64
78 0.59
79 0.56
80 0.51
81 0.49
82 0.49
83 0.5
84 0.51
85 0.54
86 0.51
87 0.49
88 0.48
89 0.42