Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7ZDD4

Protein Details
Accession A0A2P7ZDD4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
82-108SILPSDKKDSRKEKKKPRPSAPPSLKAHydrophilic
NLS Segment(s)
PositionSequence
68-104PSKPAKPAPEAAAPSILPSDKKDSRKEKKKPRPSAPP
Subcellular Location(s) cyto 13, cyto_mito 12.333, mito 10.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MCLACYPTTTLPTILAPAPPPAAPAPAPVRSVRFSVPNAYESWSCYPSNQLQLIPAPPIVIPKPAAAPSKPAKPAPEAAAPSILPSDKKDSRKEKKKPRPSAPPSLKAGATFVYPRKNTYVHLIKETKVWEEGKGKGGWSFKIHRVPVSLSVGEFVEAFMGEEAGGWSVTEVVELGDGEWDEGTSVKFGDDKAKGTMGSFGWNERRGSDLPPVWLVLHKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.16
4 0.17
5 0.18
6 0.16
7 0.18
8 0.16
9 0.18
10 0.17
11 0.21
12 0.24
13 0.25
14 0.28
15 0.28
16 0.31
17 0.3
18 0.32
19 0.29
20 0.29
21 0.27
22 0.32
23 0.32
24 0.3
25 0.29
26 0.3
27 0.28
28 0.27
29 0.29
30 0.25
31 0.23
32 0.22
33 0.26
34 0.26
35 0.32
36 0.3
37 0.26
38 0.25
39 0.27
40 0.28
41 0.24
42 0.2
43 0.14
44 0.13
45 0.15
46 0.14
47 0.14
48 0.14
49 0.13
50 0.15
51 0.19
52 0.22
53 0.19
54 0.25
55 0.27
56 0.33
57 0.36
58 0.36
59 0.34
60 0.34
61 0.36
62 0.34
63 0.35
64 0.29
65 0.26
66 0.26
67 0.24
68 0.21
69 0.19
70 0.15
71 0.1
72 0.11
73 0.18
74 0.22
75 0.27
76 0.35
77 0.45
78 0.55
79 0.65
80 0.74
81 0.78
82 0.83
83 0.89
84 0.91
85 0.89
86 0.89
87 0.86
88 0.87
89 0.83
90 0.78
91 0.7
92 0.62
93 0.53
94 0.41
95 0.35
96 0.24
97 0.18
98 0.14
99 0.13
100 0.17
101 0.17
102 0.19
103 0.2
104 0.21
105 0.21
106 0.27
107 0.32
108 0.28
109 0.34
110 0.35
111 0.33
112 0.35
113 0.35
114 0.28
115 0.23
116 0.22
117 0.19
118 0.21
119 0.23
120 0.24
121 0.23
122 0.22
123 0.22
124 0.23
125 0.22
126 0.23
127 0.25
128 0.27
129 0.34
130 0.34
131 0.32
132 0.33
133 0.33
134 0.33
135 0.33
136 0.27
137 0.2
138 0.2
139 0.19
140 0.16
141 0.14
142 0.09
143 0.05
144 0.05
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.03
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.06
166 0.05
167 0.05
168 0.05
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.07
175 0.08
176 0.16
177 0.18
178 0.2
179 0.22
180 0.24
181 0.24
182 0.23
183 0.27
184 0.2
185 0.23
186 0.21
187 0.24
188 0.29
189 0.33
190 0.33
191 0.3
192 0.34
193 0.3
194 0.32
195 0.36
196 0.32
197 0.32
198 0.33
199 0.33
200 0.3