Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P7Z0U9

Protein Details
Accession A0A2P7Z0U9    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-42QPLLPTRSSKRIRARRDRAAQATPHydrophilic
NLS Segment(s)
PositionSequence
26-37SSKRIRARRDRA
91-110PAKSGIKLRLRFPPKRPVKR
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MAPTKTSSQRPAKRFAPQQPLLPTRSSKRIRARRDRAAQATPSTPRKLTIRLKHTAPRLSSTPTTSQIPRRPRIWLKHTTPRPVSSLPPVPAKSGIKLRLRFPPKRPVKREPIAPQDTMDTSCPPVRPSVMVKSEPSSPANGLAMMLAIPLLPKGPSPGALRPSPWFHGPFSFGTLQYLLGEKVDKGDEDVDEATDAACRRLERFNLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.72
4 0.67
5 0.69
6 0.7
7 0.69
8 0.62
9 0.57
10 0.53
11 0.48
12 0.54
13 0.52
14 0.52
15 0.59
16 0.66
17 0.73
18 0.78
19 0.82
20 0.82
21 0.86
22 0.86
23 0.82
24 0.78
25 0.71
26 0.64
27 0.6
28 0.56
29 0.52
30 0.47
31 0.41
32 0.38
33 0.37
34 0.42
35 0.47
36 0.49
37 0.5
38 0.52
39 0.57
40 0.6
41 0.64
42 0.61
43 0.53
44 0.48
45 0.44
46 0.44
47 0.41
48 0.38
49 0.35
50 0.31
51 0.33
52 0.32
53 0.37
54 0.4
55 0.46
56 0.47
57 0.46
58 0.51
59 0.55
60 0.6
61 0.59
62 0.61
63 0.6
64 0.65
65 0.69
66 0.69
67 0.65
68 0.58
69 0.55
70 0.48
71 0.43
72 0.38
73 0.38
74 0.32
75 0.34
76 0.32
77 0.29
78 0.31
79 0.3
80 0.27
81 0.26
82 0.31
83 0.33
84 0.34
85 0.36
86 0.41
87 0.48
88 0.51
89 0.5
90 0.54
91 0.58
92 0.65
93 0.7
94 0.69
95 0.7
96 0.69
97 0.72
98 0.69
99 0.68
100 0.61
101 0.55
102 0.47
103 0.4
104 0.36
105 0.29
106 0.23
107 0.14
108 0.13
109 0.15
110 0.15
111 0.13
112 0.14
113 0.13
114 0.15
115 0.17
116 0.22
117 0.25
118 0.26
119 0.27
120 0.28
121 0.3
122 0.3
123 0.27
124 0.22
125 0.18
126 0.17
127 0.16
128 0.14
129 0.11
130 0.09
131 0.08
132 0.06
133 0.05
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.04
141 0.07
142 0.08
143 0.12
144 0.17
145 0.22
146 0.26
147 0.28
148 0.3
149 0.31
150 0.35
151 0.34
152 0.34
153 0.31
154 0.28
155 0.3
156 0.31
157 0.28
158 0.28
159 0.27
160 0.23
161 0.23
162 0.21
163 0.19
164 0.17
165 0.17
166 0.12
167 0.11
168 0.12
169 0.1
170 0.12
171 0.13
172 0.12
173 0.13
174 0.14
175 0.14
176 0.16
177 0.16
178 0.14
179 0.13
180 0.13
181 0.11
182 0.12
183 0.13
184 0.11
185 0.13
186 0.14
187 0.16
188 0.23