Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2U997

Protein Details
Accession Q2U997    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
122-141ISSGRRDWEEKKRERERDRPBasic
NLS Segment(s)
PositionSequence
64-85RKGKEGERRGGRSARDLPPRDR
131-141EKKRERERDRP
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013170  mRNA_splic_Cwf21_dom  
Gene Ontology GO:0005634  C:nucleus  
KEGG aor:AO090701000119  -  
Pfam View protein in Pfam  
PF08312  cwf21  
Amino Acid Sequences MEERDRLEEENERIEEELAERKKKGDKEDGEEQEGKILSDEEIEERCEALRERLVKEMEEEEERKGKEGERRGGRSARDLPPRDRRQFKAYQVHELAEAKIEESERLRKALGIKEDKETGEISSGRRDWEEKKRERERDRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.19
4 0.25
5 0.25
6 0.28
7 0.28
8 0.3
9 0.37
10 0.41
11 0.46
12 0.47
13 0.48
14 0.51
15 0.61
16 0.62
17 0.61
18 0.57
19 0.5
20 0.43
21 0.37
22 0.3
23 0.2
24 0.16
25 0.1
26 0.09
27 0.1
28 0.08
29 0.09
30 0.1
31 0.1
32 0.09
33 0.1
34 0.1
35 0.11
36 0.11
37 0.14
38 0.16
39 0.18
40 0.23
41 0.23
42 0.22
43 0.23
44 0.22
45 0.2
46 0.2
47 0.2
48 0.17
49 0.2
50 0.2
51 0.19
52 0.18
53 0.19
54 0.22
55 0.28
56 0.34
57 0.36
58 0.4
59 0.42
60 0.45
61 0.43
62 0.43
63 0.43
64 0.41
65 0.43
66 0.44
67 0.47
68 0.54
69 0.62
70 0.64
71 0.64
72 0.61
73 0.59
74 0.63
75 0.64
76 0.64
77 0.57
78 0.58
79 0.53
80 0.49
81 0.44
82 0.39
83 0.3
84 0.22
85 0.2
86 0.12
87 0.12
88 0.11
89 0.11
90 0.13
91 0.19
92 0.18
93 0.19
94 0.19
95 0.2
96 0.24
97 0.29
98 0.36
99 0.37
100 0.38
101 0.41
102 0.44
103 0.42
104 0.39
105 0.33
106 0.25
107 0.22
108 0.22
109 0.19
110 0.24
111 0.24
112 0.25
113 0.26
114 0.29
115 0.32
116 0.41
117 0.5
118 0.52
119 0.62
120 0.71
121 0.79