Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2U120

Protein Details
Accession Q2U120   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-97TIIITMSRRNCKKKRTKPPINSNHNGKTQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9plas 9, mito 5, cyto_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLPNFPRPKRPFPWPAFRGDWDDKFSASAHTQTEPLFDRATWMVEYYFCIFFLLVTITVSISITTSTVTIIITMSRRNCKKKRTKPPINSNHNGKTQSGTST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.65
4 0.62
5 0.6
6 0.56
7 0.51
8 0.45
9 0.43
10 0.36
11 0.32
12 0.29
13 0.24
14 0.2
15 0.19
16 0.16
17 0.16
18 0.17
19 0.16
20 0.18
21 0.18
22 0.18
23 0.16
24 0.14
25 0.15
26 0.15
27 0.16
28 0.13
29 0.11
30 0.1
31 0.09
32 0.11
33 0.11
34 0.11
35 0.09
36 0.09
37 0.08
38 0.08
39 0.08
40 0.07
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.08
60 0.12
61 0.16
62 0.25
63 0.33
64 0.43
65 0.5
66 0.59
67 0.69
68 0.76
69 0.83
70 0.85
71 0.89
72 0.9
73 0.95
74 0.95
75 0.93
76 0.91
77 0.88
78 0.84
79 0.8
80 0.71
81 0.61
82 0.55