Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UE67

Protein Details
Accession Q2UE67    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
90-110APFPLRRPQRPQLRRNRHLPPHydrophilic
143-164IIHSIRLRRRPRDGLRAARPTNHydrophilic
NLS Segment(s)
PositionSequence
97-114PQRPQLRRNRHLPPPTRK
149-162LRRRPRDGLRAARP
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 6, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
PROSITE View protein in PROSITE  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MSTPTQLQPPASPTYILRGHASPIHGLHIFHQNLRLISGDADGWIIVWDLVFKRPVAVWKAHEGAILEVKGFTFSNQTVTEVYTKESTTAPFPLRRPQRPQLRRNRHLPPPTRKTPLHNSSRPNHANRHGHGRYPLLLIHQGIIHSIRLRRRPRDGLRAARPTNHARLFRKSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.29
5 0.24
6 0.26
7 0.27
8 0.28
9 0.24
10 0.22
11 0.24
12 0.22
13 0.21
14 0.21
15 0.27
16 0.27
17 0.25
18 0.28
19 0.27
20 0.26
21 0.26
22 0.25
23 0.16
24 0.15
25 0.15
26 0.11
27 0.09
28 0.08
29 0.07
30 0.06
31 0.06
32 0.05
33 0.04
34 0.04
35 0.05
36 0.06
37 0.08
38 0.09
39 0.08
40 0.09
41 0.11
42 0.15
43 0.17
44 0.2
45 0.21
46 0.24
47 0.26
48 0.26
49 0.26
50 0.22
51 0.19
52 0.19
53 0.16
54 0.11
55 0.09
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.08
62 0.11
63 0.11
64 0.12
65 0.12
66 0.13
67 0.14
68 0.12
69 0.13
70 0.11
71 0.11
72 0.11
73 0.11
74 0.11
75 0.11
76 0.14
77 0.15
78 0.18
79 0.19
80 0.26
81 0.34
82 0.39
83 0.45
84 0.5
85 0.59
86 0.65
87 0.73
88 0.76
89 0.79
90 0.8
91 0.8
92 0.79
93 0.77
94 0.76
95 0.76
96 0.75
97 0.73
98 0.73
99 0.72
100 0.67
101 0.64
102 0.66
103 0.65
104 0.64
105 0.62
106 0.62
107 0.59
108 0.67
109 0.67
110 0.61
111 0.58
112 0.58
113 0.59
114 0.55
115 0.61
116 0.53
117 0.5
118 0.5
119 0.46
120 0.39
121 0.33
122 0.31
123 0.23
124 0.24
125 0.21
126 0.18
127 0.16
128 0.14
129 0.14
130 0.14
131 0.13
132 0.15
133 0.19
134 0.26
135 0.34
136 0.43
137 0.49
138 0.57
139 0.66
140 0.7
141 0.77
142 0.79
143 0.8
144 0.81
145 0.84
146 0.78
147 0.73
148 0.71
149 0.67
150 0.66
151 0.64
152 0.63
153 0.58