Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A232M0I9

Protein Details
Accession A0A232M0I9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
202-228QGHVAHPPSQQQRKRHRSPSIENIKVEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MARWRHQTVHGQVAHPPVTPREQQQNRTAAAWRNPTVQGHVAHPPRPQNRPVTLVSTDGWRNMTVQGHVPHPPRQNIMRTVRVPGEGDRQILPTAQGHVTHPPRQQTRPVFIPSDGWKNMTVQGHVAHPPRRPGITVRVPRRILSMAQGDVAYPPQQQNTTIPSEDDSQRLQTVQGYATHPLQQQNINLPIETDNCRSEIAQGHVAHPPSQQQRKRHRSPSIENIKVEEGEEEESKPIFRYPAYSISAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.39
3 0.35
4 0.29
5 0.31
6 0.34
7 0.36
8 0.41
9 0.47
10 0.51
11 0.57
12 0.6
13 0.56
14 0.55
15 0.54
16 0.5
17 0.5
18 0.51
19 0.45
20 0.43
21 0.43
22 0.42
23 0.42
24 0.39
25 0.33
26 0.29
27 0.36
28 0.36
29 0.37
30 0.4
31 0.45
32 0.47
33 0.51
34 0.52
35 0.51
36 0.51
37 0.53
38 0.51
39 0.47
40 0.42
41 0.39
42 0.34
43 0.31
44 0.27
45 0.24
46 0.23
47 0.17
48 0.17
49 0.17
50 0.18
51 0.15
52 0.2
53 0.2
54 0.21
55 0.27
56 0.29
57 0.34
58 0.38
59 0.39
60 0.38
61 0.41
62 0.43
63 0.46
64 0.49
65 0.49
66 0.45
67 0.45
68 0.43
69 0.39
70 0.35
71 0.29
72 0.3
73 0.23
74 0.24
75 0.21
76 0.21
77 0.2
78 0.19
79 0.17
80 0.11
81 0.12
82 0.12
83 0.12
84 0.12
85 0.19
86 0.23
87 0.28
88 0.3
89 0.34
90 0.38
91 0.39
92 0.46
93 0.43
94 0.44
95 0.43
96 0.43
97 0.38
98 0.34
99 0.35
100 0.3
101 0.31
102 0.27
103 0.24
104 0.21
105 0.2
106 0.24
107 0.21
108 0.18
109 0.13
110 0.14
111 0.14
112 0.17
113 0.2
114 0.2
115 0.21
116 0.24
117 0.24
118 0.24
119 0.24
120 0.23
121 0.27
122 0.33
123 0.4
124 0.43
125 0.49
126 0.5
127 0.49
128 0.49
129 0.42
130 0.33
131 0.28
132 0.25
133 0.17
134 0.17
135 0.17
136 0.14
137 0.13
138 0.13
139 0.1
140 0.08
141 0.09
142 0.1
143 0.1
144 0.11
145 0.13
146 0.16
147 0.19
148 0.18
149 0.17
150 0.18
151 0.21
152 0.21
153 0.21
154 0.19
155 0.17
156 0.17
157 0.17
158 0.15
159 0.13
160 0.13
161 0.13
162 0.15
163 0.15
164 0.17
165 0.18
166 0.22
167 0.23
168 0.24
169 0.25
170 0.25
171 0.25
172 0.28
173 0.32
174 0.29
175 0.26
176 0.24
177 0.23
178 0.24
179 0.26
180 0.23
181 0.18
182 0.19
183 0.2
184 0.19
185 0.2
186 0.22
187 0.22
188 0.26
189 0.26
190 0.27
191 0.31
192 0.32
193 0.3
194 0.26
195 0.3
196 0.33
197 0.42
198 0.47
199 0.53
200 0.63
201 0.73
202 0.81
203 0.83
204 0.83
205 0.83
206 0.85
207 0.86
208 0.86
209 0.82
210 0.73
211 0.67
212 0.59
213 0.5
214 0.42
215 0.31
216 0.22
217 0.19
218 0.19
219 0.17
220 0.16
221 0.16
222 0.17
223 0.17
224 0.17
225 0.15
226 0.14
227 0.18
228 0.21
229 0.27