Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A232LY48

Protein Details
Accession A0A232LY48    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSPSYKHYQPPKRPTETPKASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 11, nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039470  Nuc_deoxyri_tr2  
Pfam View protein in Pfam  
PF15891  Nuc_deoxyri_tr2  
Amino Acid Sequences MSSPSYKHYQPPKRPTETPKASIFLAGTIEMGTAPLWQQDLADMLRDLPIAVFNPRRDDFDPNLTQEKKNKLFAEQVNWEMDYLEKCDLIALYFVPDTKSPISLLELGLYAKDKKLIVCCPKGFWRKGNVDMVCDRHGIPLIQTYDEFKQAIEMKARELCGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.82
4 0.79
5 0.74
6 0.68
7 0.61
8 0.54
9 0.48
10 0.4
11 0.3
12 0.22
13 0.17
14 0.12
15 0.09
16 0.09
17 0.07
18 0.07
19 0.06
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.08
28 0.08
29 0.09
30 0.09
31 0.08
32 0.09
33 0.09
34 0.09
35 0.06
36 0.07
37 0.07
38 0.11
39 0.15
40 0.16
41 0.22
42 0.23
43 0.27
44 0.28
45 0.33
46 0.32
47 0.36
48 0.37
49 0.34
50 0.4
51 0.37
52 0.38
53 0.38
54 0.43
55 0.38
56 0.42
57 0.39
58 0.35
59 0.4
60 0.39
61 0.4
62 0.34
63 0.32
64 0.27
65 0.26
66 0.24
67 0.17
68 0.16
69 0.1
70 0.09
71 0.08
72 0.07
73 0.06
74 0.07
75 0.06
76 0.06
77 0.06
78 0.04
79 0.05
80 0.05
81 0.06
82 0.07
83 0.07
84 0.09
85 0.1
86 0.1
87 0.1
88 0.1
89 0.12
90 0.12
91 0.12
92 0.1
93 0.1
94 0.09
95 0.09
96 0.1
97 0.09
98 0.08
99 0.1
100 0.1
101 0.12
102 0.17
103 0.25
104 0.31
105 0.38
106 0.39
107 0.41
108 0.5
109 0.56
110 0.56
111 0.53
112 0.54
113 0.52
114 0.57
115 0.61
116 0.53
117 0.49
118 0.49
119 0.48
120 0.41
121 0.37
122 0.31
123 0.24
124 0.25
125 0.2
126 0.17
127 0.2
128 0.2
129 0.2
130 0.2
131 0.23
132 0.23
133 0.25
134 0.24
135 0.17
136 0.22
137 0.24
138 0.28
139 0.31
140 0.3
141 0.32
142 0.36