Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M0W6

Protein Details
Accession E2M0W6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22HRKKREAKIKRDVKRGIREPNEBasic
NLS Segment(s)
PositionSequence
2-16RKKREAKIKRDVKRG
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR032672  TmcA/NAT10/Kre33  
IPR013562  TmcA_N  
Gene Ontology GO:0008080  F:N-acetyltransferase activity  
KEGG mpr:MPER_13337  -  
Pfam View protein in Pfam  
PF08351  TmcA_N  
Amino Acid Sequences HRKKREAKIKRDVKRGIREPNEQNPFEIFVTVTDIRYTYYKESHKILGHTYGMLILQDFEAITPNLLARTIETVQGGGLVVLLLKSMSSLKQLYTMTMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.83
4 0.79
5 0.78
6 0.76
7 0.77
8 0.75
9 0.64
10 0.57
11 0.48
12 0.44
13 0.36
14 0.29
15 0.19
16 0.11
17 0.16
18 0.15
19 0.14
20 0.12
21 0.12
22 0.12
23 0.13
24 0.15
25 0.12
26 0.17
27 0.2
28 0.22
29 0.24
30 0.28
31 0.29
32 0.28
33 0.27
34 0.24
35 0.22
36 0.19
37 0.17
38 0.12
39 0.1
40 0.09
41 0.07
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.05
56 0.1
57 0.1
58 0.11
59 0.11
60 0.11
61 0.11
62 0.11
63 0.11
64 0.06
65 0.05
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.05
74 0.06
75 0.1
76 0.12
77 0.12
78 0.18
79 0.19