Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A232LZB0

Protein Details
Accession A0A232LZB0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89MIRSSRKKAAKAKAAGKKKAHydrophilic
NLS Segment(s)
PositionSequence
73-89SSRKKAAKAKAAGKKKA
Subcellular Location(s) plas 17, E.R. 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLGQLVGSVMLLVATAIFLYYTAWTLLMPFVDTKHPLHDLFPPRVWAIRIPVILTLLGSAVVGSFLGIVMIRSSRKKAAKAKAAGKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.03
6 0.04
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.06
15 0.07
16 0.06
17 0.07
18 0.1
19 0.12
20 0.12
21 0.14
22 0.17
23 0.16
24 0.17
25 0.23
26 0.26
27 0.28
28 0.28
29 0.27
30 0.25
31 0.25
32 0.24
33 0.18
34 0.16
35 0.16
36 0.16
37 0.15
38 0.14
39 0.14
40 0.13
41 0.12
42 0.09
43 0.05
44 0.05
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.04
57 0.07
58 0.1
59 0.13
60 0.17
61 0.25
62 0.3
63 0.38
64 0.47
65 0.55
66 0.62
67 0.68
68 0.75
69 0.77