Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167HVR4

Protein Details
Accession A0A167HVR4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
93-118SRPPSIRSRMSRKSRRSRRGDNFEPQHydrophilic
NLS Segment(s)
PositionSequence
99-111RSRMSRKSRRSRR
Subcellular Location(s) nucl 18, cyto_nucl 13.333, cyto 6.5, cyto_mito 5.166
Family & Domain DBs
Amino Acid Sequences MDGRDVTCASPTASVSSPLSKFGTLGAQQVTSPYLSESAHVFSLQHPVGKVLEDGSGEDAKVSRNSDATEVDVQRNENSPDPILDVLSAETASRPPSIRSRMSRKSRRSRRGDNFEPQDELRDSIDSECIPTKHNIIHDKDHELDNSSRSYVRLSWISTWSHNLGKTGAWLKEELAHSKLSHKIFSRDHAHRRHSRPSLCAISSSSRRSSIKNTHKDGARIFLGTNIFVPQIFNSLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.25
4 0.25
5 0.26
6 0.27
7 0.24
8 0.23
9 0.21
10 0.25
11 0.2
12 0.23
13 0.21
14 0.2
15 0.19
16 0.2
17 0.2
18 0.14
19 0.13
20 0.1
21 0.11
22 0.1
23 0.11
24 0.12
25 0.13
26 0.13
27 0.13
28 0.12
29 0.11
30 0.19
31 0.18
32 0.19
33 0.17
34 0.18
35 0.18
36 0.18
37 0.18
38 0.11
39 0.12
40 0.1
41 0.11
42 0.12
43 0.12
44 0.11
45 0.11
46 0.11
47 0.11
48 0.13
49 0.14
50 0.12
51 0.13
52 0.14
53 0.16
54 0.16
55 0.17
56 0.21
57 0.21
58 0.22
59 0.22
60 0.22
61 0.21
62 0.23
63 0.22
64 0.19
65 0.19
66 0.17
67 0.16
68 0.17
69 0.15
70 0.13
71 0.11
72 0.09
73 0.07
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.07
80 0.08
81 0.08
82 0.1
83 0.17
84 0.22
85 0.28
86 0.34
87 0.42
88 0.5
89 0.6
90 0.68
91 0.72
92 0.78
93 0.82
94 0.86
95 0.85
96 0.86
97 0.86
98 0.86
99 0.82
100 0.79
101 0.74
102 0.65
103 0.59
104 0.48
105 0.41
106 0.32
107 0.26
108 0.18
109 0.13
110 0.12
111 0.1
112 0.11
113 0.08
114 0.09
115 0.1
116 0.1
117 0.11
118 0.11
119 0.12
120 0.14
121 0.19
122 0.24
123 0.26
124 0.31
125 0.31
126 0.34
127 0.34
128 0.34
129 0.29
130 0.26
131 0.24
132 0.2
133 0.19
134 0.16
135 0.15
136 0.14
137 0.15
138 0.12
139 0.14
140 0.15
141 0.16
142 0.17
143 0.2
144 0.22
145 0.21
146 0.24
147 0.23
148 0.23
149 0.22
150 0.21
151 0.18
152 0.17
153 0.2
154 0.21
155 0.2
156 0.18
157 0.18
158 0.17
159 0.22
160 0.24
161 0.23
162 0.2
163 0.2
164 0.2
165 0.23
166 0.29
167 0.25
168 0.28
169 0.28
170 0.34
171 0.34
172 0.41
173 0.46
174 0.49
175 0.56
176 0.6
177 0.66
178 0.69
179 0.72
180 0.75
181 0.75
182 0.71
183 0.66
184 0.66
185 0.63
186 0.55
187 0.5
188 0.44
189 0.42
190 0.44
191 0.45
192 0.4
193 0.39
194 0.4
195 0.42
196 0.47
197 0.5
198 0.55
199 0.6
200 0.64
201 0.65
202 0.68
203 0.7
204 0.63
205 0.58
206 0.5
207 0.41
208 0.35
209 0.32
210 0.28
211 0.24
212 0.22
213 0.17
214 0.16
215 0.14
216 0.16
217 0.11
218 0.14