FuNGI

A0A167G3R3

Protein Details

Accession

A0A167G3R3

Localization Confidence

Medium

Confidence Score

11.2

NoLS Segment(s)

Position	Sequence	Protein Nature
388-415	RAIDKVWARAWRRRKKRGQRGCGEDEDG	Basic

NLS Segment(s)

Position	Sequence
396-405	RAWRRRKKRG

Subcellular Location(s)

nucl 11.5, cyto_nucl 10, cyto 7.5, mito 4, pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR010286 METTL16/RlmF IPR029063 SAM-dependent_MTases_sf
Gene Ontology	GO:0008168 F:methyltransferase activity GO:0006725 P:cellular aromatic compound metabolic process GO:0034641 P:cellular nitrogen compound metabolic process GO:0046483 P:heterocycle metabolic process GO:1901360 P:organic cyclic compound metabolic process GO:0044238 P:primary metabolic process
Pfam	View protein in Pfam PF05971 Methyltransf_10

Amino Acid Sequences

MQRKRKAYPEAEASAPVEPATSSTASSASKLTAVPYSANAADLRFKALYSKPSDFKQLARLDPEFAAVVKGRDLNFRDPESVLQLTKTLLKLDFGLKIELPSDRLCPPVPNRHNYILWLKDLLDTSSYDGPARKLTGMDIGTGASCIYPLLGCSQRPWSFIATDIDGESLKWARRNVEINDLSSRIKVVDRSMDGPMIPLDELALASIDFTMTNPPFYMSEEDLLSVARKKRRPPYTACTGSTTEMVTPGGELAFVDRILNESRILRERIQWYSAMFGFLSNLTTFIEQLRAAGICNYAVTEFVQGNKTRRWAVAWSFQPMRPSQHVARGTRSASSKNILPHVTEAEVISVEFPESIGEFASKITAAIASLDLISWQWDTQEYQGNGRAIDKVWARAWRRRKKRGQRGCGEDEDGAISETDVKCMFGFKVWVRVSMKEVVVGCRWLEGFDATAFESFQGFLKSTAQEAANLN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.4
2	0.34
3	0.25
4	0.17
5	0.13
6	0.12
7	0.13
8	0.12
9	0.11
10	0.12
11	0.15
12	0.15
13	0.17
14	0.17
15	0.14
16	0.15
17	0.15
18	0.16
19	0.16
20	0.17
21	0.17
22	0.17
23	0.2
24	0.19
25	0.2
26	0.18
27	0.17
28	0.2
29	0.2
30	0.23
31	0.19
32	0.18
33	0.22
34	0.26
35	0.32
36	0.34
37	0.41
38	0.41
39	0.43
40	0.51
41	0.48
42	0.46
43	0.48
44	0.47
45	0.44
46	0.46
47	0.45
48	0.4
49	0.38
50	0.37
51	0.28
52	0.22
53	0.2
54	0.15
55	0.15
56	0.14
57	0.17
58	0.17
59	0.23
60	0.27
61	0.32
62	0.35
63	0.37
64	0.38
65	0.35
66	0.36
67	0.34
68	0.32
69	0.26
70	0.21
71	0.19
72	0.18
73	0.2
74	0.2
75	0.17
76	0.15
77	0.16
78	0.17
79	0.19
80	0.22
81	0.2
82	0.22
83	0.19
84	0.2
85	0.2
86	0.19
87	0.19
88	0.16
89	0.17
90	0.16
91	0.18
92	0.19
93	0.23
94	0.29
95	0.38
96	0.43
97	0.45
98	0.5
99	0.53
100	0.53
101	0.51
102	0.51
103	0.43
104	0.38
105	0.34
106	0.28
107	0.26
108	0.25
109	0.22
110	0.16
111	0.14
112	0.15
113	0.16
114	0.16
115	0.15
116	0.16
117	0.16
118	0.17
119	0.18
120	0.16
121	0.14
122	0.14
123	0.18
124	0.17
125	0.16
126	0.14
127	0.13
128	0.12
129	0.12
130	0.11
131	0.05
132	0.05
133	0.04
134	0.04
135	0.03
136	0.04
137	0.08
138	0.11
139	0.12
140	0.14
141	0.22
142	0.24
143	0.25
144	0.27
145	0.24
146	0.22
147	0.24
148	0.25
149	0.18
150	0.17
151	0.15
152	0.14
153	0.12
154	0.12
155	0.1
156	0.11
157	0.11
158	0.14
159	0.15
160	0.16
161	0.21
162	0.26
163	0.27
164	0.34
165	0.34
166	0.33
167	0.34
168	0.34
169	0.3
170	0.25
171	0.23
172	0.14
173	0.13
174	0.12
175	0.12
176	0.14
177	0.16
178	0.18
179	0.19
180	0.18
181	0.17
182	0.16
183	0.15
184	0.11
185	0.09
186	0.06
187	0.05
188	0.05
189	0.05
190	0.04
191	0.04
192	0.03
193	0.03
194	0.03
195	0.03
196	0.03
197	0.03
198	0.08
199	0.08
200	0.08
201	0.08
202	0.09
203	0.1
204	0.11
205	0.14
206	0.11
207	0.12
208	0.11
209	0.11
210	0.11
211	0.1
212	0.1
213	0.11
214	0.14
215	0.19
216	0.23
217	0.29
218	0.38
219	0.47
220	0.52
221	0.55
222	0.58
223	0.62
224	0.64
225	0.59
226	0.54
227	0.47
228	0.42
229	0.35
230	0.28
231	0.18
232	0.13
233	0.12
234	0.08
235	0.06
236	0.05
237	0.04
238	0.04
239	0.03
240	0.04
241	0.04
242	0.04
243	0.04
244	0.04
245	0.06
246	0.07
247	0.08
248	0.09
249	0.09
250	0.11
251	0.15
252	0.18
253	0.17
254	0.22
255	0.25
256	0.26
257	0.27
258	0.25
259	0.22
260	0.22
261	0.21
262	0.17
263	0.13
264	0.1
265	0.09
266	0.09
267	0.09
268	0.06
269	0.07
270	0.06
271	0.07
272	0.07
273	0.07
274	0.08
275	0.07
276	0.07
277	0.08
278	0.07
279	0.07
280	0.08
281	0.08
282	0.06
283	0.06
284	0.06
285	0.05
286	0.06
287	0.06
288	0.07
289	0.07
290	0.09
291	0.13
292	0.16
293	0.19
294	0.21
295	0.24
296	0.24
297	0.24
298	0.25
299	0.26
300	0.27
301	0.33
302	0.33
303	0.36
304	0.37
305	0.38
306	0.38
307	0.35
308	0.36
309	0.31
310	0.34
311	0.31
312	0.36
313	0.41
314	0.41
315	0.44
316	0.43
317	0.4
318	0.39
319	0.39
320	0.33
321	0.29
322	0.29
323	0.28
324	0.27
325	0.31
326	0.28
327	0.26
328	0.25
329	0.25
330	0.23
331	0.2
332	0.17
333	0.13
334	0.12
335	0.1
336	0.09
337	0.07
338	0.06
339	0.05
340	0.05
341	0.05
342	0.05
343	0.05
344	0.05
345	0.05
346	0.05
347	0.06
348	0.06
349	0.06
350	0.06
351	0.06
352	0.05
353	0.05
354	0.06
355	0.06
356	0.06
357	0.06
358	0.06
359	0.06
360	0.05
361	0.07
362	0.06
363	0.06
364	0.06
365	0.08
366	0.09
367	0.12
368	0.21
369	0.21
370	0.23
371	0.29
372	0.29
373	0.29
374	0.28
375	0.27
376	0.19
377	0.24
378	0.23
379	0.22
380	0.25
381	0.32
382	0.37
383	0.44
384	0.54
385	0.59
386	0.68
387	0.75
388	0.82
389	0.86
390	0.92
391	0.94
392	0.94
393	0.93
394	0.91
395	0.88
396	0.81
397	0.73
398	0.62
399	0.52
400	0.42
401	0.32
402	0.24
403	0.16
404	0.11
405	0.14
406	0.13
407	0.15
408	0.14
409	0.14
410	0.13
411	0.16
412	0.16
413	0.13
414	0.19
415	0.19
416	0.29
417	0.29
418	0.36
419	0.37
420	0.38
421	0.4
422	0.4
423	0.38
424	0.33
425	0.33
426	0.3
427	0.3
428	0.3
429	0.26
430	0.22
431	0.22
432	0.18
433	0.18
434	0.15
435	0.14
436	0.13
437	0.14
438	0.13
439	0.13
440	0.13
441	0.12
442	0.12
443	0.1
444	0.11
445	0.12
446	0.12
447	0.13
448	0.17
449	0.18
450	0.18
451	0.22
452	0.21

A0A167G3R3

3D AlphaFold-predicted Structure Viewer