Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166YGP4

Protein Details
Accession A0A166YGP4    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
25-45EKGDPKKTWGRGRGRARRDKEBasic
NLS Segment(s)
PositionSequence
27-45GDPKKTWGRGRGRARRDKE
Subcellular Location(s) nucl 10.5, cyto_nucl 9, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0004386  F:helicase activity  
Amino Acid Sequences MPGHLHPMLVRKYHEISRLRHSFLEKGDPKKTWGRGRGRARRDKEGDEDGEGNKKRPDVEDIKAESLAALRQLEGSGATWLSAKQEECMHAIMRLGGARHLICVLRTGAGKSNLFMAPALMRDDRRGGAILDAYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.45
4 0.51
5 0.54
6 0.52
7 0.51
8 0.5
9 0.46
10 0.43
11 0.49
12 0.45
13 0.46
14 0.48
15 0.46
16 0.47
17 0.5
18 0.55
19 0.53
20 0.56
21 0.59
22 0.63
23 0.73
24 0.78
25 0.8
26 0.82
27 0.79
28 0.8
29 0.75
30 0.69
31 0.64
32 0.59
33 0.51
34 0.43
35 0.39
36 0.3
37 0.33
38 0.3
39 0.26
40 0.22
41 0.21
42 0.19
43 0.19
44 0.25
45 0.22
46 0.24
47 0.29
48 0.3
49 0.31
50 0.3
51 0.28
52 0.22
53 0.17
54 0.14
55 0.08
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.07
69 0.08
70 0.08
71 0.09
72 0.11
73 0.12
74 0.14
75 0.15
76 0.14
77 0.13
78 0.13
79 0.11
80 0.1
81 0.1
82 0.09
83 0.08
84 0.1
85 0.09
86 0.1
87 0.11
88 0.11
89 0.1
90 0.12
91 0.12
92 0.12
93 0.13
94 0.14
95 0.19
96 0.23
97 0.24
98 0.22
99 0.25
100 0.23
101 0.23
102 0.21
103 0.17
104 0.13
105 0.14
106 0.18
107 0.16
108 0.17
109 0.19
110 0.23
111 0.22
112 0.22
113 0.22
114 0.19
115 0.19