Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167GPH1

Protein Details
Accession A0A167GPH1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-110DKKPDDKKPDDKKPDDKKPDTKPNYNECKKBasic
NLS Segment(s)
Subcellular Location(s) extr 24, golg 2
Family & Domain DBs
Amino Acid Sequences MRFSLALVAAFAAFSIAAPVTDGCEAPSVPSSSAKPAEASAAPDTDTILNPGNVPGSKPLDGKKPADDNTNNKVDNEKPDDKKPDDKKPDDKKPDDKKPDTKPNYNECKKYEVQRNWKAWMKCRNEQDSIKGSNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.04
4 0.04
5 0.06
6 0.06
7 0.07
8 0.08
9 0.09
10 0.08
11 0.1
12 0.1
13 0.1
14 0.13
15 0.13
16 0.13
17 0.16
18 0.17
19 0.2
20 0.22
21 0.21
22 0.19
23 0.17
24 0.19
25 0.17
26 0.19
27 0.16
28 0.15
29 0.15
30 0.14
31 0.14
32 0.12
33 0.12
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.11
40 0.1
41 0.1
42 0.11
43 0.13
44 0.14
45 0.16
46 0.18
47 0.23
48 0.26
49 0.27
50 0.28
51 0.3
52 0.3
53 0.35
54 0.37
55 0.35
56 0.37
57 0.41
58 0.37
59 0.32
60 0.33
61 0.28
62 0.3
63 0.32
64 0.34
65 0.33
66 0.38
67 0.45
68 0.46
69 0.54
70 0.55
71 0.58
72 0.6
73 0.63
74 0.68
75 0.72
76 0.79
77 0.79
78 0.79
79 0.79
80 0.8
81 0.83
82 0.83
83 0.81
84 0.79
85 0.8
86 0.84
87 0.81
88 0.8
89 0.77
90 0.77
91 0.81
92 0.79
93 0.75
94 0.67
95 0.66
96 0.62
97 0.63
98 0.63
99 0.62
100 0.66
101 0.69
102 0.71
103 0.71
104 0.75
105 0.72
106 0.7
107 0.7
108 0.67
109 0.66
110 0.7
111 0.7
112 0.69
113 0.68
114 0.67
115 0.64