Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167A5S6

Protein Details
Accession A0A167A5S6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSRFQKRRHRLRLRAVDSVHydrophilic
77-103KYTMFDRKAKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
83-97RKAKRYRKGIHKLPK
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRVTNPLSGGLLWKIPWRLSRFQKRRHRLRLRAVDSVVATLDEALAGKGLTLEALERWKAEMPTEAEMLPKDKYTMFDRKAKRYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.16
5 0.17
6 0.19
7 0.26
8 0.29
9 0.36
10 0.45
11 0.56
12 0.61
13 0.7
14 0.78
15 0.82
16 0.87
17 0.9
18 0.9
19 0.88
20 0.9
21 0.9
22 0.85
23 0.8
24 0.69
25 0.6
26 0.5
27 0.41
28 0.3
29 0.19
30 0.13
31 0.07
32 0.06
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.02
43 0.03
44 0.03
45 0.05
46 0.06
47 0.06
48 0.07
49 0.09
50 0.09
51 0.1
52 0.13
53 0.14
54 0.16
55 0.17
56 0.16
57 0.15
58 0.15
59 0.16
60 0.13
61 0.11
62 0.1
63 0.1
64 0.13
65 0.18
66 0.27
67 0.3
68 0.38
69 0.44
70 0.54
71 0.62
72 0.68
73 0.71
74 0.72
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79