Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167H794

Protein Details
Accession A0A167H794    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
128-157EQKAYQKSIREQEKKRREQQREEERRKGEEBasic
NLS Segment(s)
PositionSequence
141-154KKRREQQREEERRK
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MSSTSGRKAKVTESLSNLTLNTSKASSKTSKSKLKSAVADSWDDDDESSGPESEFKPSVTSPTFPSAPPPTPFAASYGSIPGWDDTRASGSTSSRGDDPYQRPEKTDAVARRMIAAGLGLKAPKQTDEQKAYQKSIREQEKKRREQQREEERRKGEETEKAKAAVWDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.42
4 0.38
5 0.32
6 0.28
7 0.22
8 0.18
9 0.16
10 0.16
11 0.16
12 0.22
13 0.24
14 0.29
15 0.38
16 0.45
17 0.53
18 0.56
19 0.62
20 0.64
21 0.66
22 0.65
23 0.61
24 0.58
25 0.51
26 0.49
27 0.42
28 0.36
29 0.3
30 0.24
31 0.19
32 0.14
33 0.11
34 0.11
35 0.1
36 0.08
37 0.08
38 0.09
39 0.1
40 0.12
41 0.13
42 0.12
43 0.13
44 0.13
45 0.18
46 0.18
47 0.19
48 0.18
49 0.22
50 0.22
51 0.2
52 0.25
53 0.25
54 0.26
55 0.26
56 0.26
57 0.23
58 0.24
59 0.24
60 0.21
61 0.18
62 0.16
63 0.15
64 0.13
65 0.12
66 0.1
67 0.1
68 0.09
69 0.08
70 0.07
71 0.07
72 0.06
73 0.08
74 0.08
75 0.08
76 0.09
77 0.09
78 0.12
79 0.13
80 0.13
81 0.12
82 0.13
83 0.14
84 0.2
85 0.23
86 0.3
87 0.36
88 0.35
89 0.36
90 0.38
91 0.38
92 0.33
93 0.37
94 0.31
95 0.29
96 0.32
97 0.3
98 0.27
99 0.26
100 0.24
101 0.16
102 0.13
103 0.09
104 0.07
105 0.08
106 0.07
107 0.07
108 0.09
109 0.09
110 0.1
111 0.14
112 0.21
113 0.28
114 0.34
115 0.4
116 0.48
117 0.51
118 0.54
119 0.53
120 0.51
121 0.49
122 0.52
123 0.57
124 0.57
125 0.63
126 0.7
127 0.77
128 0.82
129 0.85
130 0.87
131 0.85
132 0.86
133 0.88
134 0.89
135 0.89
136 0.88
137 0.88
138 0.81
139 0.77
140 0.69
141 0.64
142 0.58
143 0.56
144 0.52
145 0.5
146 0.49
147 0.46
148 0.44