Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LQ95

Protein Details
Accession E2LQ95    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-108DSIKAQEKRLKKLRSKLKRAKKNLTDSKVPHydrophilic
NLS Segment(s)
PositionSequence
85-101EKRLKKLRSKLKRAKKN
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG mpr:MPER_09090  -  
Amino Acid Sequences TVKRGDTKSCKASMRPSSDRGGKNGTSSTLNGRFHQSQATDGDDSHQGTVSLDVPDTFMSFLTEEIVTSYKEEISHATDSIKAQEKRLKKLRSKLKRAKKNLTDSKVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.61
3 0.58
4 0.59
5 0.63
6 0.61
7 0.55
8 0.52
9 0.44
10 0.41
11 0.38
12 0.33
13 0.27
14 0.25
15 0.28
16 0.29
17 0.3
18 0.29
19 0.33
20 0.32
21 0.31
22 0.33
23 0.27
24 0.22
25 0.21
26 0.23
27 0.18
28 0.17
29 0.18
30 0.16
31 0.16
32 0.14
33 0.12
34 0.09
35 0.08
36 0.09
37 0.09
38 0.07
39 0.06
40 0.06
41 0.07
42 0.06
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.07
53 0.08
54 0.07
55 0.08
56 0.08
57 0.08
58 0.08
59 0.09
60 0.1
61 0.13
62 0.14
63 0.14
64 0.14
65 0.15
66 0.15
67 0.2
68 0.27
69 0.24
70 0.28
71 0.35
72 0.4
73 0.48
74 0.57
75 0.62
76 0.61
77 0.7
78 0.77
79 0.81
80 0.86
81 0.87
82 0.89
83 0.9
84 0.91
85 0.93
86 0.91
87 0.91
88 0.91