Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167CY41

Protein Details
Accession A0A167CY41   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPRRKRAAPKRQSKWNSDNILHydrophilic
NLS Segment(s)
PositionSequence
3-11RRKRAAPKR
Subcellular Location(s) mito 12, nucl 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028020  ASX_DEUBAD_dom  
IPR044867  DEUBAD_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13919  ASXH  
PROSITE View protein in PROSITE  
PS51916  DEUBAD  
Amino Acid Sequences MPRRKRAAPKRQSKWNSDNILTDPQSPLASADLRSVLSNPLAWTSLSVEERKEVLSLFPDMAHTLDADTDDARPNFETLMNDDSFRYDCAAYVDHLARGRHDPVWLEDAWRAHDRRKAGEFEEWLGDKFVEDWGVEIPDASKVKPKDEGKTDGKADESSEAAITQQLNGFTASTPTPREGGLVQNEADNDDTIYVVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.79
4 0.71
5 0.66
6 0.59
7 0.59
8 0.5
9 0.44
10 0.36
11 0.3
12 0.27
13 0.23
14 0.2
15 0.15
16 0.15
17 0.13
18 0.14
19 0.14
20 0.14
21 0.14
22 0.14
23 0.14
24 0.13
25 0.13
26 0.12
27 0.12
28 0.12
29 0.12
30 0.12
31 0.12
32 0.16
33 0.17
34 0.18
35 0.17
36 0.18
37 0.19
38 0.18
39 0.16
40 0.12
41 0.1
42 0.11
43 0.12
44 0.11
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.07
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.1
58 0.1
59 0.11
60 0.11
61 0.11
62 0.11
63 0.12
64 0.12
65 0.11
66 0.15
67 0.14
68 0.14
69 0.14
70 0.15
71 0.14
72 0.13
73 0.12
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.11
80 0.11
81 0.11
82 0.14
83 0.14
84 0.14
85 0.15
86 0.16
87 0.14
88 0.15
89 0.14
90 0.13
91 0.16
92 0.15
93 0.14
94 0.14
95 0.14
96 0.17
97 0.2
98 0.19
99 0.19
100 0.23
101 0.23
102 0.26
103 0.29
104 0.28
105 0.27
106 0.3
107 0.28
108 0.26
109 0.27
110 0.23
111 0.2
112 0.18
113 0.16
114 0.11
115 0.1
116 0.09
117 0.07
118 0.06
119 0.06
120 0.06
121 0.07
122 0.07
123 0.07
124 0.07
125 0.11
126 0.11
127 0.11
128 0.17
129 0.18
130 0.2
131 0.29
132 0.32
133 0.35
134 0.4
135 0.48
136 0.46
137 0.52
138 0.51
139 0.44
140 0.42
141 0.35
142 0.3
143 0.24
144 0.2
145 0.14
146 0.12
147 0.11
148 0.09
149 0.11
150 0.1
151 0.09
152 0.11
153 0.1
154 0.11
155 0.11
156 0.12
157 0.1
158 0.12
159 0.13
160 0.13
161 0.15
162 0.16
163 0.17
164 0.16
165 0.18
166 0.17
167 0.22
168 0.25
169 0.26
170 0.25
171 0.26
172 0.26
173 0.25
174 0.25
175 0.19
176 0.14
177 0.11