Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166XDE3

Protein Details
Accession A0A166XDE3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
81-106EELKQRGKSAPKKKSGPPVEKPGKRRBasic
NLS Segment(s)
PositionSequence
85-106QRGKSAPKKKSGPPVEKPGKRR
Subcellular Location(s) mito 14.5, cyto_mito 12, cyto 8.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPRARLLDLMKAQCQVFATIYNPEGVRMGNKVLRQRLKGPAVAAYYPRKVATIKDVKREFGPVLATWDEAEEDRFEYIEELKQRGKSAPKKKSGPPVEKPGKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.32
4 0.25
5 0.19
6 0.16
7 0.16
8 0.15
9 0.16
10 0.17
11 0.16
12 0.15
13 0.14
14 0.13
15 0.12
16 0.11
17 0.14
18 0.15
19 0.19
20 0.24
21 0.32
22 0.36
23 0.38
24 0.41
25 0.46
26 0.45
27 0.44
28 0.39
29 0.34
30 0.31
31 0.29
32 0.28
33 0.24
34 0.22
35 0.21
36 0.2
37 0.17
38 0.15
39 0.15
40 0.21
41 0.27
42 0.29
43 0.37
44 0.38
45 0.39
46 0.39
47 0.4
48 0.32
49 0.23
50 0.22
51 0.13
52 0.16
53 0.15
54 0.15
55 0.13
56 0.13
57 0.11
58 0.1
59 0.1
60 0.07
61 0.08
62 0.07
63 0.08
64 0.07
65 0.08
66 0.09
67 0.13
68 0.15
69 0.17
70 0.21
71 0.23
72 0.25
73 0.29
74 0.38
75 0.43
76 0.51
77 0.58
78 0.64
79 0.69
80 0.75
81 0.8
82 0.81
83 0.81
84 0.78
85 0.8
86 0.81