Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166ZGN6

Protein Details
Accession A0A166ZGN6   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MNNRPRNRQPRPSRHGQGQKKNRRSDPSSSHydrophilic
NLS Segment(s)
PositionSequence
6-23RNRQPRPSRHGQGQKKNR
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019240  DUF2196  
Pfam View protein in Pfam  
PF09962  DUF2196  
Amino Acid Sequences MNNRPRNRQPRPSRHGQGQKKNRRSDPSSSLGSSQSSPTTPQQAAGTVPTVQQVIPGASVHIILKEDQPTGIETTGVVGELLTRGNHPRGIKVRLRNGQVGRVQRMSNEAETASSAVQDSNANSTKPKPPSRFSHRYTDMRNDLDCPSEPPPRSLADFLPPSPLANDTNSDGTTNYVEVNCPFCDSFTGDEAAVTHHIDREHLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.87
5 0.87
6 0.9
7 0.88
8 0.9
9 0.87
10 0.85
11 0.8
12 0.78
13 0.74
14 0.69
15 0.64
16 0.56
17 0.5
18 0.43
19 0.39
20 0.32
21 0.26
22 0.22
23 0.18
24 0.2
25 0.21
26 0.25
27 0.23
28 0.24
29 0.23
30 0.22
31 0.22
32 0.2
33 0.19
34 0.14
35 0.14
36 0.13
37 0.12
38 0.11
39 0.11
40 0.1
41 0.09
42 0.09
43 0.08
44 0.08
45 0.07
46 0.08
47 0.08
48 0.07
49 0.08
50 0.08
51 0.1
52 0.11
53 0.12
54 0.11
55 0.11
56 0.12
57 0.13
58 0.12
59 0.1
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.04
66 0.04
67 0.04
68 0.05
69 0.04
70 0.05
71 0.08
72 0.09
73 0.13
74 0.13
75 0.18
76 0.23
77 0.29
78 0.34
79 0.38
80 0.45
81 0.48
82 0.5
83 0.51
84 0.47
85 0.47
86 0.45
87 0.43
88 0.37
89 0.34
90 0.31
91 0.25
92 0.27
93 0.23
94 0.19
95 0.15
96 0.12
97 0.1
98 0.11
99 0.11
100 0.08
101 0.06
102 0.06
103 0.05
104 0.06
105 0.06
106 0.06
107 0.1
108 0.12
109 0.12
110 0.13
111 0.16
112 0.23
113 0.3
114 0.38
115 0.38
116 0.43
117 0.52
118 0.61
119 0.66
120 0.63
121 0.66
122 0.65
123 0.66
124 0.65
125 0.64
126 0.6
127 0.53
128 0.5
129 0.43
130 0.36
131 0.33
132 0.28
133 0.23
134 0.23
135 0.27
136 0.28
137 0.27
138 0.28
139 0.27
140 0.3
141 0.28
142 0.25
143 0.25
144 0.27
145 0.26
146 0.29
147 0.27
148 0.25
149 0.23
150 0.24
151 0.18
152 0.17
153 0.19
154 0.17
155 0.19
156 0.19
157 0.19
158 0.17
159 0.17
160 0.16
161 0.14
162 0.13
163 0.11
164 0.12
165 0.13
166 0.16
167 0.15
168 0.17
169 0.17
170 0.15
171 0.17
172 0.19
173 0.2
174 0.19
175 0.2
176 0.17
177 0.17
178 0.17
179 0.17
180 0.16
181 0.15
182 0.13
183 0.14
184 0.15