Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162JVC9

Protein Details
Accession A0A162JVC9   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-70HTGDAPQTKKEPKRRRRAKRRQELDVEARMBasic
NLS Segment(s)
PositionSequence
49-61KKEPKRRRRAKRR
275-288RLRWKGGKVHRRRH
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
Amino Acid Sequences MAGSASDTASDPANDPEDDDNGETNYAVFRDCLSSVLLLAHTGDAPQTKKEPKRRRRAKRRQELDVEARMTPETDHHSTADELAEFIDYLASGIFDGLPEALRTLNHRAWRESNSLQVQFALPLTLDCLSVIDLPPSVPDTLVTYNLVAEDPTFDSQLPATTEHFLSPIVTAYIETLITPPPASWASRTDACEICKRDWIPLSYHHLIPRFVHEKAIKRGWHHKEDLQNVAWLCGACHRFVHQFRNHEELARNFYTVELLLAEEDVRKFAAWVGRLRWKGGKVHRRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.19
4 0.19
5 0.2
6 0.2
7 0.19
8 0.16
9 0.17
10 0.14
11 0.13
12 0.12
13 0.1
14 0.09
15 0.08
16 0.09
17 0.11
18 0.11
19 0.12
20 0.12
21 0.12
22 0.12
23 0.13
24 0.12
25 0.09
26 0.09
27 0.09
28 0.08
29 0.08
30 0.09
31 0.11
32 0.13
33 0.16
34 0.22
35 0.3
36 0.39
37 0.5
38 0.6
39 0.67
40 0.76
41 0.85
42 0.9
43 0.92
44 0.95
45 0.95
46 0.95
47 0.93
48 0.91
49 0.88
50 0.85
51 0.81
52 0.76
53 0.67
54 0.56
55 0.48
56 0.39
57 0.31
58 0.23
59 0.18
60 0.18
61 0.18
62 0.19
63 0.19
64 0.2
65 0.2
66 0.21
67 0.19
68 0.13
69 0.1
70 0.09
71 0.08
72 0.06
73 0.06
74 0.05
75 0.04
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.04
87 0.05
88 0.05
89 0.06
90 0.09
91 0.15
92 0.18
93 0.23
94 0.25
95 0.28
96 0.31
97 0.35
98 0.38
99 0.33
100 0.36
101 0.35
102 0.34
103 0.31
104 0.28
105 0.24
106 0.18
107 0.17
108 0.11
109 0.06
110 0.05
111 0.06
112 0.06
113 0.05
114 0.05
115 0.05
116 0.06
117 0.06
118 0.06
119 0.06
120 0.05
121 0.05
122 0.06
123 0.07
124 0.06
125 0.05
126 0.05
127 0.08
128 0.08
129 0.09
130 0.09
131 0.08
132 0.08
133 0.08
134 0.08
135 0.05
136 0.04
137 0.05
138 0.06
139 0.07
140 0.07
141 0.07
142 0.07
143 0.08
144 0.09
145 0.09
146 0.09
147 0.1
148 0.11
149 0.11
150 0.11
151 0.11
152 0.1
153 0.09
154 0.08
155 0.07
156 0.06
157 0.05
158 0.05
159 0.05
160 0.06
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.06
167 0.06
168 0.08
169 0.09
170 0.1
171 0.11
172 0.13
173 0.17
174 0.21
175 0.23
176 0.24
177 0.26
178 0.28
179 0.33
180 0.34
181 0.31
182 0.33
183 0.32
184 0.32
185 0.34
186 0.33
187 0.29
188 0.32
189 0.39
190 0.36
191 0.38
192 0.37
193 0.35
194 0.35
195 0.33
196 0.35
197 0.3
198 0.28
199 0.32
200 0.33
201 0.39
202 0.44
203 0.51
204 0.46
205 0.47
206 0.57
207 0.58
208 0.61
209 0.58
210 0.56
211 0.57
212 0.6
213 0.6
214 0.5
215 0.47
216 0.39
217 0.36
218 0.31
219 0.22
220 0.17
221 0.18
222 0.18
223 0.15
224 0.16
225 0.19
226 0.26
227 0.32
228 0.41
229 0.41
230 0.47
231 0.51
232 0.56
233 0.53
234 0.49
235 0.5
236 0.44
237 0.45
238 0.39
239 0.35
240 0.29
241 0.29
242 0.25
243 0.2
244 0.16
245 0.09
246 0.08
247 0.08
248 0.08
249 0.08
250 0.1
251 0.1
252 0.1
253 0.1
254 0.1
255 0.1
256 0.13
257 0.18
258 0.2
259 0.25
260 0.31
261 0.4
262 0.42
263 0.46
264 0.48
265 0.47
266 0.52
267 0.58
268 0.62