Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166X0J0

Protein Details
Accession A0A166X0J0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
318-346TDTLNSKNGNKPKKDKKLPAVGRAARKTRHydrophilic
NLS Segment(s)
PositionSequence
326-346GNKPKKDKKLPAVGRAARKTR
Subcellular Location(s) cyto 18.5, cyto_nucl 14.5, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MTDVDVPAVDKASAHGPDVIKPASKDSAPAEQPFLAVCPPAPAHMIEGDDARRADKLLDEPTDEMVPSAEENKLNGRVGHSLVPPKPVQVMSVPETPVNGSTPAGGTPRPELTIPEDPSPSAAKPPGEPDIEPVVLTGAEEPKATPATSVPDEKESKPSPDGGMMEIDKPEEKQLPPVTHTGPESESVPAPAPAPVAAPVAAPLPEMPDAPAITTGEPPASTPAAQVNENVVGGKRKLDEEDVVPPVDGATRTDSHSADNQAASTTLPLDKKPKLGEHAANSSGDASKAAAPVPVSSSAPTLNADPVPDPPAASPALTDTLNSKNGNKPKKDKKLPAVGRAARKTRSQGPADV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.21
4 0.25
5 0.3
6 0.3
7 0.28
8 0.28
9 0.31
10 0.3
11 0.29
12 0.28
13 0.28
14 0.34
15 0.35
16 0.36
17 0.36
18 0.32
19 0.32
20 0.29
21 0.26
22 0.18
23 0.14
24 0.12
25 0.12
26 0.13
27 0.14
28 0.15
29 0.14
30 0.15
31 0.16
32 0.17
33 0.14
34 0.17
35 0.16
36 0.18
37 0.18
38 0.17
39 0.15
40 0.15
41 0.15
42 0.15
43 0.18
44 0.21
45 0.22
46 0.24
47 0.25
48 0.26
49 0.26
50 0.23
51 0.18
52 0.13
53 0.11
54 0.1
55 0.11
56 0.11
57 0.11
58 0.12
59 0.16
60 0.19
61 0.2
62 0.2
63 0.21
64 0.21
65 0.22
66 0.26
67 0.25
68 0.29
69 0.29
70 0.33
71 0.31
72 0.29
73 0.3
74 0.26
75 0.24
76 0.2
77 0.23
78 0.22
79 0.26
80 0.26
81 0.23
82 0.23
83 0.22
84 0.2
85 0.16
86 0.13
87 0.09
88 0.09
89 0.09
90 0.1
91 0.11
92 0.11
93 0.11
94 0.13
95 0.14
96 0.14
97 0.14
98 0.14
99 0.19
100 0.27
101 0.28
102 0.28
103 0.27
104 0.26
105 0.27
106 0.28
107 0.22
108 0.17
109 0.17
110 0.15
111 0.16
112 0.19
113 0.21
114 0.21
115 0.21
116 0.21
117 0.23
118 0.22
119 0.21
120 0.18
121 0.14
122 0.12
123 0.12
124 0.09
125 0.06
126 0.06
127 0.07
128 0.07
129 0.08
130 0.09
131 0.09
132 0.08
133 0.08
134 0.12
135 0.14
136 0.16
137 0.15
138 0.2
139 0.23
140 0.23
141 0.29
142 0.27
143 0.27
144 0.26
145 0.26
146 0.22
147 0.21
148 0.21
149 0.15
150 0.15
151 0.13
152 0.13
153 0.12
154 0.11
155 0.09
156 0.09
157 0.1
158 0.11
159 0.1
160 0.15
161 0.19
162 0.2
163 0.22
164 0.24
165 0.24
166 0.22
167 0.23
168 0.19
169 0.15
170 0.15
171 0.14
172 0.12
173 0.11
174 0.1
175 0.1
176 0.09
177 0.09
178 0.08
179 0.07
180 0.06
181 0.07
182 0.07
183 0.07
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.05
191 0.06
192 0.07
193 0.07
194 0.07
195 0.08
196 0.08
197 0.08
198 0.09
199 0.08
200 0.08
201 0.09
202 0.08
203 0.08
204 0.07
205 0.08
206 0.09
207 0.09
208 0.08
209 0.09
210 0.12
211 0.14
212 0.14
213 0.14
214 0.14
215 0.13
216 0.13
217 0.13
218 0.1
219 0.11
220 0.11
221 0.13
222 0.12
223 0.12
224 0.14
225 0.16
226 0.17
227 0.17
228 0.22
229 0.22
230 0.21
231 0.2
232 0.18
233 0.16
234 0.15
235 0.13
236 0.09
237 0.11
238 0.12
239 0.14
240 0.17
241 0.17
242 0.18
243 0.22
244 0.23
245 0.21
246 0.2
247 0.18
248 0.15
249 0.15
250 0.13
251 0.1
252 0.09
253 0.11
254 0.12
255 0.15
256 0.21
257 0.23
258 0.27
259 0.31
260 0.34
261 0.36
262 0.42
263 0.45
264 0.45
265 0.49
266 0.46
267 0.42
268 0.38
269 0.34
270 0.27
271 0.21
272 0.15
273 0.11
274 0.11
275 0.11
276 0.11
277 0.11
278 0.11
279 0.12
280 0.14
281 0.15
282 0.14
283 0.14
284 0.15
285 0.14
286 0.15
287 0.15
288 0.14
289 0.15
290 0.15
291 0.15
292 0.15
293 0.16
294 0.18
295 0.17
296 0.17
297 0.14
298 0.16
299 0.15
300 0.14
301 0.13
302 0.12
303 0.15
304 0.14
305 0.14
306 0.15
307 0.19
308 0.24
309 0.26
310 0.27
311 0.33
312 0.43
313 0.52
314 0.58
315 0.63
316 0.69
317 0.79
318 0.86
319 0.88
320 0.88
321 0.9
322 0.9
323 0.88
324 0.88
325 0.84
326 0.84
327 0.82
328 0.79
329 0.72
330 0.69
331 0.67
332 0.65
333 0.66