Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167H6U5

Protein Details
Accession A0A167H6U5    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
11-52EPSSTAKKPKRGFRVGPDNLPDGPWRRKVTKIKKDLIQKAKVHydrophilic
NLS Segment(s)
PositionSequence
16-60AKKPKRGFRVGPDNLPDGPWRRKVTKIKKDLIQKAKVKKEYAKIK
157-194RERERRTEERERKMAERQRFKKAMAKTVGKDGKKKLGR
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MAPKRPLESGEPSSTAKKPKRGFRVGPDNLPDGPWRRKVTKIKKDLIQKAKVKKEYAKIKAREQQTCQSRHGKDHDEVGGGADSQGEADRLQEEAEEKMHPTRELMLKDEDKAQAGVDAATDSTSDGMRRRTRRPGYYDKQLQKAQERQEAYEEKTRERERRTEERERKMAERQRFKKAMAKTVGKDGKKKLGRESTLLLDKVKRMMEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.49
4 0.52
5 0.55
6 0.61
7 0.69
8 0.74
9 0.76
10 0.77
11 0.81
12 0.77
13 0.76
14 0.7
15 0.63
16 0.54
17 0.48
18 0.42
19 0.37
20 0.38
21 0.39
22 0.4
23 0.41
24 0.49
25 0.59
26 0.66
27 0.7
28 0.73
29 0.73
30 0.74
31 0.81
32 0.82
33 0.8
34 0.79
35 0.76
36 0.76
37 0.78
38 0.76
39 0.71
40 0.67
41 0.67
42 0.68
43 0.7
44 0.7
45 0.65
46 0.68
47 0.7
48 0.71
49 0.68
50 0.63
51 0.62
52 0.61
53 0.6
54 0.56
55 0.58
56 0.53
57 0.52
58 0.52
59 0.48
60 0.42
61 0.42
62 0.39
63 0.31
64 0.29
65 0.24
66 0.19
67 0.13
68 0.12
69 0.07
70 0.05
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.07
83 0.07
84 0.08
85 0.09
86 0.11
87 0.1
88 0.1
89 0.12
90 0.16
91 0.16
92 0.18
93 0.2
94 0.2
95 0.21
96 0.23
97 0.2
98 0.17
99 0.16
100 0.14
101 0.1
102 0.09
103 0.08
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.06
113 0.08
114 0.15
115 0.22
116 0.27
117 0.32
118 0.42
119 0.49
120 0.55
121 0.61
122 0.65
123 0.64
124 0.7
125 0.75
126 0.7
127 0.69
128 0.65
129 0.62
130 0.59
131 0.59
132 0.55
133 0.52
134 0.48
135 0.42
136 0.46
137 0.45
138 0.41
139 0.42
140 0.38
141 0.33
142 0.4
143 0.45
144 0.46
145 0.48
146 0.51
147 0.52
148 0.61
149 0.67
150 0.7
151 0.73
152 0.76
153 0.78
154 0.75
155 0.7
156 0.7
157 0.7
158 0.69
159 0.7
160 0.67
161 0.7
162 0.69
163 0.68
164 0.65
165 0.63
166 0.62
167 0.6
168 0.61
169 0.53
170 0.6
171 0.66
172 0.63
173 0.64
174 0.6
175 0.62
176 0.61
177 0.62
178 0.61
179 0.63
180 0.63
181 0.61
182 0.59
183 0.57
184 0.57
185 0.55
186 0.49
187 0.42
188 0.4
189 0.4