Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167HBE4

Protein Details
Accession A0A167HBE4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
123-149EHEPRRGTGSRRSRRRSRDRRRSRRYSBasic
NLS Segment(s)
PositionSequence
127-148RRGTGSRRSRRRSRDRRRSRRY
Subcellular Location(s) mito 13, nucl 7, cyto 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPTLHARQSTPTTPVLIPTAYGDVDSSPSPGAVVGIVLGSVAGALLLLYLVYAALGCAPSVMVLLPATRDMSSVSSFRPRRRGSRAAEVEEVRVPPPPPPPPVVVAMDEPSLADDEVVVIEEHEPRRGTGSRRSRRRSRDRRRSRRYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.28
4 0.22
5 0.19
6 0.17
7 0.17
8 0.13
9 0.13
10 0.11
11 0.09
12 0.11
13 0.11
14 0.11
15 0.09
16 0.09
17 0.08
18 0.08
19 0.08
20 0.05
21 0.05
22 0.04
23 0.03
24 0.03
25 0.03
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.01
32 0.01
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.08
60 0.09
61 0.1
62 0.1
63 0.18
64 0.22
65 0.25
66 0.33
67 0.35
68 0.4
69 0.47
70 0.54
71 0.5
72 0.58
73 0.59
74 0.54
75 0.55
76 0.49
77 0.43
78 0.37
79 0.33
80 0.22
81 0.19
82 0.16
83 0.14
84 0.19
85 0.21
86 0.22
87 0.24
88 0.26
89 0.26
90 0.29
91 0.28
92 0.25
93 0.22
94 0.21
95 0.19
96 0.17
97 0.14
98 0.11
99 0.1
100 0.08
101 0.06
102 0.05
103 0.05
104 0.05
105 0.06
106 0.05
107 0.04
108 0.06
109 0.11
110 0.12
111 0.15
112 0.16
113 0.16
114 0.21
115 0.25
116 0.28
117 0.34
118 0.45
119 0.52
120 0.62
121 0.71
122 0.76
123 0.82
124 0.89
125 0.91
126 0.91
127 0.92
128 0.93
129 0.95