Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166ZYV7

Protein Details
Accession A0A166ZYV7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
124-152APAPTNERTRRTRRTRRTRRTNGWMDGWKHydrophilic
NLS Segment(s)
PositionSequence
133-142RRTRRTRRTR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MAVFVEEDRVSSDWDQIPVIFKSEVTIGEPVGNEAKCPRSTKGDEAVIQMQCRAEQAAAKTLLHLTQARSKGEKEFEPEQLVSAACRHASSSSIEGEEAKKDNGVDLEPKRRCNRQNNSIRTEAPAPTNERTRRTRRTRRTRRTNGWMDGWKGTASNTNKGRSKMTGARGVGQPQPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.2
4 0.23
5 0.2
6 0.23
7 0.17
8 0.15
9 0.15
10 0.16
11 0.16
12 0.14
13 0.14
14 0.12
15 0.13
16 0.14
17 0.14
18 0.17
19 0.16
20 0.14
21 0.17
22 0.21
23 0.23
24 0.26
25 0.27
26 0.31
27 0.35
28 0.4
29 0.43
30 0.44
31 0.42
32 0.43
33 0.46
34 0.39
35 0.35
36 0.31
37 0.24
38 0.19
39 0.18
40 0.14
41 0.09
42 0.1
43 0.11
44 0.16
45 0.17
46 0.17
47 0.17
48 0.17
49 0.17
50 0.17
51 0.17
52 0.13
53 0.18
54 0.22
55 0.23
56 0.24
57 0.25
58 0.26
59 0.28
60 0.27
61 0.26
62 0.26
63 0.26
64 0.27
65 0.26
66 0.23
67 0.2
68 0.19
69 0.13
70 0.11
71 0.09
72 0.06
73 0.07
74 0.07
75 0.06
76 0.07
77 0.09
78 0.09
79 0.1
80 0.1
81 0.1
82 0.1
83 0.11
84 0.12
85 0.11
86 0.1
87 0.09
88 0.09
89 0.1
90 0.09
91 0.1
92 0.14
93 0.17
94 0.27
95 0.29
96 0.36
97 0.4
98 0.46
99 0.53
100 0.57
101 0.62
102 0.63
103 0.71
104 0.73
105 0.74
106 0.71
107 0.63
108 0.56
109 0.5
110 0.41
111 0.33
112 0.29
113 0.28
114 0.27
115 0.36
116 0.37
117 0.4
118 0.46
119 0.53
120 0.59
121 0.66
122 0.74
123 0.76
124 0.84
125 0.89
126 0.92
127 0.95
128 0.95
129 0.94
130 0.93
131 0.91
132 0.85
133 0.81
134 0.76
135 0.68
136 0.59
137 0.5
138 0.4
139 0.31
140 0.27
141 0.27
142 0.25
143 0.31
144 0.34
145 0.41
146 0.46
147 0.48
148 0.51
149 0.46
150 0.51
151 0.5
152 0.52
153 0.52
154 0.49
155 0.52
156 0.52
157 0.52