Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167E3S7

Protein Details
Accession A0A167E3S7    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-42GMRKNGKQWHEQKKAFRPTKBasic
79-122IDKMREKRAKKEENERYEKMAETMHRKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
17-118KPAKSLGMRKNGKQWHEQKKAFRPTKGLTSFEKRAKERAAMAQMKAKEKEMKEEKEVMRKEKIDKMREKRAKKEENERYEKMAETMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MPGNEVPALVPVEAREKPAKSLGMRKNGKQWHEQKKAFRPTKGLTSFEKRAKERAAMAQMKAKEKEMKEEKEVMRKEKIDKMREKRAKKEENERYEKMAETMHRKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.23
4 0.26
5 0.3
6 0.34
7 0.33
8 0.43
9 0.46
10 0.51
11 0.55
12 0.55
13 0.6
14 0.61
15 0.61
16 0.6
17 0.63
18 0.63
19 0.68
20 0.71
21 0.71
22 0.74
23 0.81
24 0.77
25 0.7
26 0.65
27 0.58
28 0.62
29 0.57
30 0.5
31 0.45
32 0.46
33 0.5
34 0.49
35 0.53
36 0.44
37 0.45
38 0.43
39 0.4
40 0.35
41 0.34
42 0.37
43 0.33
44 0.32
45 0.32
46 0.33
47 0.34
48 0.32
49 0.29
50 0.26
51 0.24
52 0.32
53 0.35
54 0.35
55 0.35
56 0.42
57 0.42
58 0.46
59 0.49
60 0.43
61 0.41
62 0.41
63 0.41
64 0.42
65 0.48
66 0.48
67 0.55
68 0.59
69 0.65
70 0.71
71 0.74
72 0.76
73 0.78
74 0.79
75 0.76
76 0.79
77 0.78
78 0.79
79 0.81
80 0.74
81 0.68
82 0.6
83 0.54
84 0.44
85 0.38
86 0.33
87 0.35
88 0.4
89 0.44
90 0.49
91 0.5
92 0.56
93 0.62
94 0.68
95 0.69
96 0.73
97 0.76
98 0.79
99 0.89
100 0.92
101 0.93
102 0.93