FuNGI

A0A162JKE1

Protein Details

Accession

A0A162JKE1

Localization Confidence

Low

Confidence Score

8.7

NoLS Segment(s)

Position	Sequence	Protein Nature
43-92	APPPTIKSRRDLPKKAKRTFKKKTNVVAVKKPSPGERKAFRKRIQLSNNS	Hydrophilic

NLS Segment(s)

Position	Sequence
48-85	IKSRRDLPKKAKRTFKKKTNVVAVKKPSPGERKAFRKR

Subcellular Location(s)

mito 21, nucl 2, cyto 2, cyto_nucl 2

Family & Domain DBs

InterPro	View protein in InterPro IPR019368 Ribosomal_S23/S29_mit IPR017082 Ribosomal_S23_mit_fun
Gene Ontology	GO:0005763 C:mitochondrial small ribosomal subunit GO:0032543 P:mitochondrial translation
Pfam	View protein in Pfam PF10236 DAP3

Amino Acid Sequences

MASSAASSLRNLVRPSIPIAPRIHPVIPSRVAFFSATSFRAAAPPPTIKSRRDLPKKAKRTFKKKTNVVAVKKPSPGERKAFRKRIQLSNNSALPVQNIDELTSGAMVNSESKGKMFALPDKVVDQLRALEAFKATQTWNLFRRPHFLVRDETVELVRKLEESLETKEALRCVLTGSKLSGKSLALLQSMSYALMNDWVVVHIPEGQDLTNGNTEYSPIDGTEPRLFAQPVYTLNLLQNIYKANKAVLEKLTLQNDWSRFTHLKQGATVADLVLSAKESEYAWPTLDALWTELTLPGRPPILFALDGLAHINKMSDYRDPSFNQIHAHELSLVRLFVDALSGQTKLPNGGAIIAATSDNNTHYHPSQELVLSQLEAGQAGREIPQPDPYQRRYDERVYESLKNSYVLRIGGVSKDEARVLMEYWGASGMLRSVLDTRTVTEKWALSGHGIVGEMERVSLMTMRM

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.31
2	0.36
3	0.39
4	0.37
5	0.39
6	0.42
7	0.41
8	0.42
9	0.45
10	0.42
11	0.38
12	0.4
13	0.41
14	0.42
15	0.4
16	0.39
17	0.36
18	0.36
19	0.31
20	0.28
21	0.25
22	0.23
23	0.23
24	0.21
25	0.21
26	0.19
27	0.22
28	0.23
29	0.22
30	0.24
31	0.28
32	0.3
33	0.39
34	0.44
35	0.42
36	0.46
37	0.52
38	0.57
39	0.62
40	0.69
41	0.71
42	0.77
43	0.85
44	0.89
45	0.9
46	0.9
47	0.9
48	0.91
49	0.9
50	0.9
51	0.88
52	0.89
53	0.89
54	0.88
55	0.85
56	0.83
57	0.81
58	0.77
59	0.72
60	0.65
61	0.62
62	0.6
63	0.59
64	0.58
65	0.59
66	0.64
67	0.71
68	0.78
69	0.76
70	0.79
71	0.79
72	0.81
73	0.81
74	0.79
75	0.77
76	0.74
77	0.7
78	0.61
79	0.54
80	0.44
81	0.35
82	0.28
83	0.21
84	0.15
85	0.13
86	0.13
87	0.12
88	0.12
89	0.11
90	0.1
91	0.09
92	0.06
93	0.06
94	0.06
95	0.07
96	0.08
97	0.09
98	0.09
99	0.09
100	0.11
101	0.11
102	0.15
103	0.16
104	0.21
105	0.26
106	0.27
107	0.28
108	0.28
109	0.3
110	0.27
111	0.25
112	0.19
113	0.14
114	0.14
115	0.14
116	0.14
117	0.12
118	0.12
119	0.12
120	0.11
121	0.12
122	0.11
123	0.14
124	0.17
125	0.21
126	0.25
127	0.31
128	0.35
129	0.35
130	0.4
131	0.4
132	0.45
133	0.43
134	0.42
135	0.4
136	0.38
137	0.41
138	0.36
139	0.32
140	0.26
141	0.25
142	0.22
143	0.18
144	0.16
145	0.12
146	0.12
147	0.11
148	0.13
149	0.13
150	0.16
151	0.17
152	0.18
153	0.19
154	0.2
155	0.19
156	0.17
157	0.14
158	0.1
159	0.1
160	0.12
161	0.12
162	0.12
163	0.13
164	0.18
165	0.18
166	0.19
167	0.18
168	0.16
169	0.16
170	0.17
171	0.16
172	0.12
173	0.11
174	0.11
175	0.1
176	0.1
177	0.09
178	0.07
179	0.05
180	0.05
181	0.06
182	0.06
183	0.05
184	0.05
185	0.05
186	0.05
187	0.05
188	0.06
189	0.06
190	0.06
191	0.07
192	0.07
193	0.07
194	0.07
195	0.07
196	0.09
197	0.09
198	0.09
199	0.09
200	0.08
201	0.09
202	0.09
203	0.09
204	0.08
205	0.05
206	0.07
207	0.07
208	0.11
209	0.12
210	0.12
211	0.12
212	0.14
213	0.13
214	0.12
215	0.12
216	0.11
217	0.1
218	0.12
219	0.12
220	0.11
221	0.11
222	0.14
223	0.13
224	0.12
225	0.12
226	0.12
227	0.12
228	0.12
229	0.12
230	0.1
231	0.13
232	0.14
233	0.16
234	0.15
235	0.16
236	0.18
237	0.21
238	0.23
239	0.2
240	0.2
241	0.2
242	0.2
243	0.21
244	0.19
245	0.21
246	0.2
247	0.21
248	0.29
249	0.29
250	0.29
251	0.26
252	0.28
253	0.23
254	0.22
255	0.21
256	0.12
257	0.09
258	0.07
259	0.07
260	0.05
261	0.05
262	0.04
263	0.04
264	0.05
265	0.05
266	0.06
267	0.09
268	0.1
269	0.1
270	0.1
271	0.1
272	0.1
273	0.1
274	0.09
275	0.08
276	0.07
277	0.07
278	0.07
279	0.08
280	0.09
281	0.09
282	0.09
283	0.1
284	0.11
285	0.11
286	0.11
287	0.11
288	0.12
289	0.11
290	0.11
291	0.11
292	0.1
293	0.1
294	0.1
295	0.09
296	0.07
297	0.07
298	0.07
299	0.06
300	0.07
301	0.08
302	0.11
303	0.16
304	0.19
305	0.25
306	0.26
307	0.31
308	0.32
309	0.32
310	0.31
311	0.27
312	0.28
313	0.24
314	0.23
315	0.2
316	0.18
317	0.17
318	0.16
319	0.15
320	0.11
321	0.1
322	0.09
323	0.07
324	0.08
325	0.06
326	0.07
327	0.08
328	0.08
329	0.08
330	0.1
331	0.11
332	0.1
333	0.1
334	0.1
335	0.09
336	0.09
337	0.09
338	0.08
339	0.07
340	0.07
341	0.07
342	0.06
343	0.06
344	0.06
345	0.07
346	0.09
347	0.1
348	0.14
349	0.14
350	0.17
351	0.17
352	0.18
353	0.19
354	0.18
355	0.17
356	0.16
357	0.15
358	0.13
359	0.12
360	0.12
361	0.1
362	0.09
363	0.08
364	0.06
365	0.06
366	0.07
367	0.08
368	0.11
369	0.13
370	0.14
371	0.21
372	0.24
373	0.32
374	0.39
375	0.42
376	0.46
377	0.48
378	0.54
379	0.53
380	0.57
381	0.58
382	0.55
383	0.58
384	0.56
385	0.58
386	0.54
387	0.52
388	0.46
389	0.4
390	0.35
391	0.3
392	0.27
393	0.21
394	0.19
395	0.17
396	0.17
397	0.17
398	0.18
399	0.19
400	0.18
401	0.19
402	0.19
403	0.17
404	0.17
405	0.16
406	0.15
407	0.14
408	0.14
409	0.12
410	0.12
411	0.12
412	0.1
413	0.09
414	0.08
415	0.07
416	0.08
417	0.08
418	0.09
419	0.11
420	0.12
421	0.16
422	0.16
423	0.18
424	0.22
425	0.23
426	0.24
427	0.26
428	0.26
429	0.25
430	0.26
431	0.25
432	0.2
433	0.22
434	0.2
435	0.16
436	0.16
437	0.14
438	0.12
439	0.13
440	0.11
441	0.1
442	0.09
443	0.08
444	0.08

A0A162JKE1

3D AlphaFold-predicted Structure Viewer