Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167KB19

Protein Details
Accession A0A167KB19   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSAKLHPPRRPSQPQPNPLPPLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018607  Ctf8  
Gene Ontology GO:0031390  C:Ctf18 RFC-like complex  
GO:0007064  P:mitotic sister chromatid cohesion  
Pfam View protein in Pfam  
PF09696  Ctf8  
Amino Acid Sequences MSAKLHPPRRPSQPQPNPLPPLVQTPSGLALLELQGTINLPQSMDGEALAGVEIGSIDFPDYTPGADGSAWTRRVQMYVGQHQRLTGEVRKLPRPVAVIRRRENRLLENSAGTYMEQGENLEVVEIVKYKIMFSNRPEPVGTAGAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.85
4 0.8
5 0.71
6 0.64
7 0.54
8 0.5
9 0.44
10 0.36
11 0.28
12 0.24
13 0.25
14 0.22
15 0.21
16 0.13
17 0.11
18 0.09
19 0.09
20 0.08
21 0.05
22 0.05
23 0.06
24 0.06
25 0.08
26 0.07
27 0.07
28 0.08
29 0.09
30 0.09
31 0.09
32 0.08
33 0.06
34 0.06
35 0.06
36 0.05
37 0.04
38 0.03
39 0.03
40 0.03
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.03
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.07
56 0.12
57 0.13
58 0.13
59 0.14
60 0.13
61 0.14
62 0.15
63 0.17
64 0.18
65 0.26
66 0.31
67 0.31
68 0.31
69 0.31
70 0.31
71 0.27
72 0.26
73 0.21
74 0.2
75 0.22
76 0.26
77 0.29
78 0.31
79 0.3
80 0.29
81 0.28
82 0.29
83 0.36
84 0.41
85 0.46
86 0.52
87 0.59
88 0.6
89 0.61
90 0.6
91 0.56
92 0.54
93 0.5
94 0.44
95 0.38
96 0.35
97 0.31
98 0.27
99 0.21
100 0.15
101 0.12
102 0.1
103 0.09
104 0.09
105 0.08
106 0.08
107 0.08
108 0.07
109 0.05
110 0.05
111 0.06
112 0.07
113 0.07
114 0.09
115 0.09
116 0.1
117 0.15
118 0.19
119 0.24
120 0.29
121 0.39
122 0.4
123 0.42
124 0.42
125 0.39
126 0.38